KEGG   Bradyrhizobium japonicum USDA110: blr5099Help
Entry
blr5099           CDS       T00109                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bja00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bja00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5655689..5656636
Genome map
AA seq 315 aa AA seqDB search
MTSKSTFVLGHRHLLGIEGLSAADITGLLDLSEEYVELNRQVDKKRTVLRGRTQVNLFFE
ASTRTQSSFELAGKRLGADVMNMSVSSSSIKKGETLVDTAMTLNAMHPDILVVRHHASGA
VELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRIEGLVVAICGDVLHSRVARSN
IILLNTMGARVRVVGPSTLLPPGIERMGVEVARDMREGLNGADIVMMLRLQRERMNGSFV
PSTSEYFNYFGLDQKKLGYAKPDALVMHPGPMNRGVEIDTAVADGAQSLIREQVEMGVAV
RMAVLEALARNLPNA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgaaatcgaccttcgtcctcggccaccggcatttgctgggcatcgagggcctt
tccgcggccgacatcaccggcctcctcgacctgtccgaagaatatgtcgagctcaaccgc
caggttgacaagaagcgcaccgtcctgcgtggacggacgcaggtgaacctcttcttcgag
gcctccacccggacccaatcctcgttcgagctcgccggcaaacggcttggcgccgacgtc
atgaacatgtcggtgtcttcctcgtccatcaagaagggcgagacgctggtcgacaccgcg
atgacgctcaatgccatgcacccggacatcctggtggtccggcatcacgcgtcaggcgcg
gtggaactgctggcccgcaaggttgacggttccgtgatcaatgccggcgacggcgcgcac
gagcatccgacgcaggcgctgctcgacgccctgaccatccgccgcaacaagggccggatc
gagggcctcgtcgtcgcgatctgcggcgacgtgctgcattcgcgtgtggcccgttccaac
atcatcctgctcaacaccatgggtgcccgcgtccgcgtcgtcggcccctccacgctgctg
ccgcccggcatcgagcggatgggcgtcgaggttgcgcgcgacatgcgcgaggggctcaac
ggcgccgacatcgtcatgatgctgcggctccagcgcgagcgcatgaacggctccttcgtg
ccgtcgacctccgaatatttcaactatttcgggctggaccagaaaaagcttggctatgcc
aagccagacgctctcgtcatgcatcccggcccgatgaaccgcggcgtcgagatcgacacc
gcggtcgccgacggcgcgcaatcgctgatccgcgaacaggtcgagatgggcgtggcggtg
cgcatggccgtgctcgaagcgctcgcccgcaacttgccgaacgcgtga

DBGET integrated database retrieval system