KEGG   Bradyrhizobium diazoefficiens USDA 110: blr5231Help
Entry
blr5231           CDS       T00109                                 

Gene name
rpoH1
Definition
(RefSeq) RNA polymerase factor sigma-32
  KO
K03089  RNA polymerase sigma-32 factor
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Transcription machinery [BR:bja03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     blr5231 (rpoH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4 Sigma70_r1_2 HTH_3 KORA GntR Sigma70_r4_2 DUF3431 HTH_28
Motif
Other DBs
NCBI-GeneID: 1051457
NCBI-ProteinID: NP_771871
RhizoBase: blr5231
UniProt: H7C6N7
Position
5782781..5783707
Genome map
AA seq 308 aa AA seqDB search
MFNNAALPAPSVDAGLSKYLVEIRKFPLLTPEQELAYARRWREHRDRDAAYHLVTSHLRL
VAKIAMRYRGYGLPIAEIVSEGNIGLMQAVRRFDPDRGVRLATYAMWWIRASIQEYILRS
WSLVKIAASASQKKLFFKLRRAKSAISALQDGDLRPEQVRLIAERLKVAERDVVAMDRRL
RGDASLNVPIHDEDEGGQTLDWLVDPAPTCEITLAEEQEAKQRRLALANALANLNARERN
IFTARWLNEESTTLEELAAEYGVSRERVRQIEERAFQKVKAAMLTSRHEANGPPSSRAKE
MKQGVARA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacaatgccgctctacctgccccgtctgtcgacgctgggctgtcgaaatatcta
gtcgagatccgtaagtttcccttgctcacgcccgagcaggagctcgcctacgcaaggcgc
tggcgcgagcaccgggatcgcgacgcagcgtaccacctggtgaccagtcatctcaggctc
gtcgccaagatagcgatgcgctatcgcggttacggcctcccgatcgcggaaattgtctcg
gaaggaaacattggcttgatgcaggctgtgaggcggtttgatccggatcggggcgttcgc
cttgccacctatgcgatgtggtggatcagggcctccatccaggagtacatcctgcggtcc
tggtcgctggtcaagatcgccgcgagcgccagccagaaaaagcttttcttcaaactgcgg
agggccaaaagcgcgatctctgcgctacaggacggcgatttgcgtccggagcaggtcagg
ctaattgctgagcgtctcaaggtggctgaacgagacgttgtcgccatggaccgccgcctg
cgtggagacgcttccttgaatgtaccgatccacgacgaggatgagggcggacaaacgttg
gattggcttgtcgatcccgcgccgacttgtgaaatcacgttggccgaggagcaggaggcc
aagcagcgtcgtctggccctcgctaacgccctcgccaacctcaacgctcgcgaacgcaac
atcttcaccgcgcgctggctgaacgaggagtcgacgacccttgaagaacttgccgcggaa
tatggagtatcccgcgaacgggttcgccagatcgaggagcgagcgtttcaaaaggtaaag
gctgcgatgctgacaagtcgacatgaggccaatggcccgccgtcttcccgcgcgaaagaa
atgaagcagggggtggcgcgggcctaa

DBGET integrated database retrieval system