KEGG   Bradyrhizobium diazoefficiens USDA 110: blr5234Help
Entry
blr5234           CDS       T00109                                 

Gene name
hspC
Definition
(RefSeq) small heat shock protein
  KO
K13993  
HSP20 family protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Chaperones and folding catalysts [BR:bja03110]
 Heat shock proteins
  HSP20
   blr5234 (hspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5784779..5785279
Genome map
AA seq 166 aa AA seqDB search
MGIKDLIPWNNGGREVGIHRGADVNPFLTLHREMNRMFDEVFRGFDLAPFGSSRGLSGLG
WPQIDIDETDKEVRITAELPGLEEKDVSLEIANGVLSISGEKKSESEDKARRFSERYYGR
FERRIPLEGIDEDKVSAAFKNGVLTITVPKSAEAKNVRRIAINRNG
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcaaggacctcattccgtggaataacggcggacgagaggtcggcattcaccgc
ggagccgatgtgaatccgtttcttacattgcatcgcgagatgaaccggatgttcgacgag
gtattccgcggctttgatcttgcgccgttcggatcgagccggggactgagcgggctcggc
tggccccagatcgacatcgatgaaacggacaaggaggtgcgcatcaccgctgagctgccc
ggcctggaggagaaggacgtcagtctcgaaatcgcgaatggagttctttcgatctccggc
gagaaaaaatccgaatcggaagacaaggcacgtcgtttcagcgaacgatactacggccga
ttcgaacggcgtatcccgctggagggcatcgacgaggacaaagtctcggccgcgttcaag
aacggcgtcctgaccataaccgtgccgaaatccgccgaagccaaaaatgtccgccgcatc
gcgatcaatcgcaatggctga

DBGET integrated database retrieval system