KEGG   Bradyrhizobium diazoefficiens USDA 110: blr5235Help
Entry
blr5235           CDS       T00109                                 

Gene name
degP
Definition
(RefSeq) serine protease
  KO
K04771  
serine protease Do [EC:3.4.21.107]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    blr5235 (degP)
 Human Diseases
  Antimicrobial resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    blr5235 (degP)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     blr5235 (degP)
Peptidases [BR:bja01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   blr5235 (degP)
Chaperones and folding catalysts [BR:bja03110]
 Other chaperones and cochaperones
  DegP / HtrA
   blr5235 (degP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5785352..5786467
Genome map
AA seq 371 aa AA seqDB search
MSKNSSVIKDRRFAAVLLLCASIAWSPVLAQVPDIRGGQIPTLAPVVRETTPSVVNISVH
ARVKEDNPLYRDPVFREFFDLPKQLEKEVQATGSGVIVDAERGYVLTANHVVAQISKAQV
TTKDGRKFDAKLVGRDPATDVAVLQLQGLRGNLKAIPLGDSDRIEVGDFVIAIGNPFGLG
QTVTSGIVSALGRTGLGKQGYEDFIQTDASINPGNSGGALINLRGQLVGINTAIISPGGG
NVGIGFAVPINMARRVMEQLVQYGEVRRGQIGISIRDLGVDLAAKESYQGALIAEIASGS
PAEQAGLQKGDIVKAVDGTPIRSASQLRNLIGLTPVGSRVELRFERNGAARSASVEVGPA
KAVPVRRTADQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaactcatcagtaataaaggatcgacggttcgccgcagtcttgctcctttgc
gcctctatcgcgtggtcgcccgtgctcgcacaggttccggacatcaggggcggccaaatc
ccgacccttgcgcctgtggtaagggaaaccaccccttcggtcgtcaacatttcggtgcac
gcccgggtcaaggaggacaatccgctctaccgcgatcccgtctttcgagagttttttgat
cttcccaagcagcttgaaaaggaagtccaggcaaccggctcgggcgtaatcgtcgacgcc
gaacgcggctatgtactcaccgccaatcacgtcgttgcgcagatctctaaggcccaagtc
acgaccaaagacggacgaaagttcgacgcaaaattggttgggcgtgaccctgcaaccgac
gttgccgttcttcaactgcaaggactaagaggtaacctcaaggccatcccgttgggtgac
agcgatcggatcgaggtcggtgatttcgtgatcgcgatcgggaaccccttcggcttgggt
cagaccgtaacttcgggaattgtcagcgccctcggccgaaccggccttggcaagcaaggg
tatgaggacttcatccagaccgacgcatccattaatcccggaaattcgggcggcgccctg
attaacctgaggggacaacttgtcgggatcaatacggcgatcatttctccgggcgggggt
aacgtcggaatcggattcgctgtgccgatcaacatggcccgccgcgtcatggagcagctt
gttcaatacggcgaagttcgtcgcggccagatcggcatatccatccgcgatcttggagtc
gatcttgcggccaaggagagctatcaaggggcgctgatcgcggagattgccagtggttcg
ccggcggagcaagcggggctgcaaaagggcgacatcgtgaaggctgtcgatggcacgccg
atccggagcgcgtcccagcttcgcaatttgattggccttaccccagtcggtagccgcgtc
gagcttcggttcgaacgcaatggcgctgctcgcagcgcgagcgtcgaggtgggtccagca
aaagctgtgcccgtgagacgcacggccgatcaatga

DBGET integrated database retrieval system