KEGG   Bradyrhizobium diazoefficiens USDA 110: blr5583Help
Entry
blr5583           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6140620..6141327
Genome map
AA seq 235 aa AA seqDB search
MTVFSAASPRSPRTRTRAHIVPIVLGGAAAVCAVALVAYLLWPTWGTSGANAPDKLPVSV
GGTLFNLPTTAIRMKIQRHSGPQERIDLDFLYPSLEPPGTPKHVSADTVDASLLPIDRIF
LSIAAHHDALSPEQRTATIYPRYLEPGATMPEDGLTMRMFRADTPYGSEDLYSAASPALT
ARCTRDAATPGMCLSERRVGGADLTFRFPRSWLSQWRDAADAMEKLTAQLRGPRG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgttttcggcagcctcccctcggtccccccggacgcgcacccgggcgcatatc
gtcccgatcgtgctcggcggcgcggcggcggtgtgcgccgtcgcgctcgtcgcctatctg
ttgtggccgacctggggcaccagcggcgccaacgcccccgacaagctgccggtgagcgtc
ggcggcacgctgttcaacctgccgacgacggcgatccggatgaagatccagcggcactcg
gggccgcaggagcgcatcgatctcgacttcctctatccctcgctggagccgcccggcacg
ccgaagcacgtcagcgccgacacggtggatgcgtcgttgctgccgatcgaccgcatcttc
ctgtcgatcgcggcccatcacgatgcgctctcgcccgagcagcggaccgccacgatctat
ccgcgctatctcgagccgggcgcgacgatgcccgaggacggactgacgatgcggatgttc
cgcgccgacacaccttacggcagcgaggatctctattctgccgcaagccccgcgctgacc
gcacgctgcacgcgcgatgcggcgaccccgggcatgtgcctctccgagcgccgcgttggc
ggcgccgacctcaccttccgctttccgcgcagctggctgtcgcagtggcgcgacgcggcg
gacgcgatggaaaagctgacggcgcagctgcgcggaccgcgcggatga

DBGET integrated database retrieval system