KEGG   Bradyrhizobium japonicum USDA110: blr6207Help
Entry
blr6207           CDS       T00109                                 

Gene name
exaA
Definition
quinoprotein ethanol dehydrogenase (EC:1.1.99.-)
Orthology
K00114  
alcohol dehydrogenase (cytochrome c) [EC:1.1.2.8]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bja00010]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bja00640]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bja00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6825071..6826735
Genome map
AA seq 554 aa AA seqDB search
MKRFAMAASLVMLASTYANAQTTEQLVKGATDTSNVLNYGMGYNLQRFSTLNQINKDTVK
NLVPVWNYSFNDDRSEESQPLVYQGVIYVTSHNATMAVDAKTGKQIWKSKIEYPAETPRI
VCCGIINRGAALYDGKVFRTTLDANVIALDAKDGKELWRQKAADIKEGYSMTVAPLVADG
VVITGISGAEFGTRGFIDGWDPATGKHLWRTHSIPSPDEPGGDTWKGDTWKLGGGSTWIT
GSYDPELNTVYWGIGNPGPFNSAVRPGDNLYTCSVLAMDPKTGKIKWHYQFSPNNPFDYD
SVAEMVLADMNVEGKPTKVLMDANRNGFFYVLDRTNGKLLAANPYVKVNWATGVDMKTGR
PIETDVSKDAREGKKVTVYPSILGGKNWEPMSFNPQTGLAYANTLAFGGKYKAEPVTFKQ
GEWYLGMDLTDPWEFGDGARGHLKAIDPMTGKAKWEAPADIPRFSGVLSTAGGVVFTGAL
TGEFEAFDADTGKKLWQFQTGSGIEGQPVTWQQDDVQYIAVTSGYGGVYSLFSGDERLAK
VPPGGSLWVFAVKQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctttgcgatggccgcgagcctcgtcatgcttgcatcaacgtatgcaaacgcc
cagaccaccgagcaactggtcaagggtgcgaccgatacatcgaacgttctcaactacggg
atgggctacaatctccagcgcttctcgaccctgaaccagatcaacaaggacacggtgaaa
aacctcgtcccggtctggaactactccttcaatgacgatcgcagcgaggaatcgcagcca
ctggtgtaccagggcgtgatctacgtgacctcgcacaacgcgaccatggcggtcgacgcc
aagaccggcaagcagatctggaaatccaagatcgagtaccccgccgagacgccgcgcatc
gtctgctgcggcatcatcaaccgcggcgccgcgctctacgacggcaaggtgttccgcacc
accctcgacgccaacgtgatcgcgctcgacgccaaggacggcaaggagctttggcggcag
aaggcggccgatatcaaggaaggctattcgatgacggtggccccgctggtcgccgacggc
gtcgtcatcaccggcatctccggcgccgagttcggcacccgcggcttcatcgacggctgg
gatccggcgacgggcaagcatctctggcgcacccattcgatcccctctcccgacgagccc
ggtggcgacacctggaagggcgacacctggaagctcggcggcggctcgacctggatcacc
ggctcctacgatcccgagctgaacacggtctattggggcatcggcaatcccggcccgttc
aactcggcggtgcgccccggcgacaacctctacacctgctccgtgctggcgatggatccc
aagaccggcaagatcaagtggcactaccagttctcgccgaacaatccgttcgactatgac
agcgtggccgagatggtcctcgccgacatgaacgtcgagggcaagccgaccaaggtgctg
atggatgccaaccgtaacggcttcttctacgtgctcgaccgcaccaacggaaagctgctc
gcggccaatccctacgtgaaggtgaactgggcgaccggcgtcgacatgaagacgggccgc
ccgatcgagaccgacgtttcgaaggacgcccgcgagggcaagaaggtgactgtctatccg
tcgatcctcggcggcaagaactgggagccgatgtcgttcaatccgcaaaccggattggcc
tacgccaacacgctcgccttcggcggcaagtacaaggccgaaccggtcaccttcaagcag
ggcgaatggtatctcggcatggacctcaccgatccctgggaattcggcgacggcgcgcgg
ggccatctgaaggcgatcgatccgatgaccggcaaggcgaagtgggaggcgcccgccgac
atcccgcgcttctccggcgtgctgtcgaccgcgggcggcgtcgtgttcacgggcgccctg
accggcgagttcgaggccttcgatgccgacaccggcaagaagctctggcagttccagacc
ggctccggcatcgagggacaaccggtgacgtggcagcaggatgacgtgcaatacatcgcc
gtcaccagcggctacggcggcgtctactcgctgttctccggcgacgagcggctcgccaag
gtgccgcccggcggctcgctgtgggtctttgcggtcaagcaatag

DBGET integrated database retrieval system