KEGG   Bradyrhizobium diazoefficiens USDA 110: blr6207Help
Entry
blr6207           CDS       T00109                                 

Gene name
exaA
Definition
quinoprotein ethanol dehydrogenase (EC:1.1.99.-)
Orthology
K00114  
alcohol dehydrogenase (cytochrome c) [EC:1.1.2.8]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr6207 (exaA)
   00640 Propanoate metabolism
    blr6207 (exaA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    blr6207 (exaA)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.8  alcohol dehydrogenase (cytochrome c)
     blr6207 (exaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6825071..6826735
Genome map
AA seq 554 aa AA seqDB search
MKRFAMAASLVMLASTYANAQTTEQLVKGATDTSNVLNYGMGYNLQRFSTLNQINKDTVK
NLVPVWNYSFNDDRSEESQPLVYQGVIYVTSHNATMAVDAKTGKQIWKSKIEYPAETPRI
VCCGIINRGAALYDGKVFRTTLDANVIALDAKDGKELWRQKAADIKEGYSMTVAPLVADG
VVITGISGAEFGTRGFIDGWDPATGKHLWRTHSIPSPDEPGGDTWKGDTWKLGGGSTWIT
GSYDPELNTVYWGIGNPGPFNSAVRPGDNLYTCSVLAMDPKTGKIKWHYQFSPNNPFDYD
SVAEMVLADMNVEGKPTKVLMDANRNGFFYVLDRTNGKLLAANPYVKVNWATGVDMKTGR
PIETDVSKDAREGKKVTVYPSILGGKNWEPMSFNPQTGLAYANTLAFGGKYKAEPVTFKQ
GEWYLGMDLTDPWEFGDGARGHLKAIDPMTGKAKWEAPADIPRFSGVLSTAGGVVFTGAL
TGEFEAFDADTGKKLWQFQTGSGIEGQPVTWQQDDVQYIAVTSGYGGVYSLFSGDERLAK
VPPGGSLWVFAVKQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctttgcgatggccgcgagcctcgtcatgcttgcatcaacgtatgcaaacgcc
cagaccaccgagcaactggtcaagggtgcgaccgatacatcgaacgttctcaactacggg
atgggctacaatctccagcgcttctcgaccctgaaccagatcaacaaggacacggtgaaa
aacctcgtcccggtctggaactactccttcaatgacgatcgcagcgaggaatcgcagcca
ctggtgtaccagggcgtgatctacgtgacctcgcacaacgcgaccatggcggtcgacgcc
aagaccggcaagcagatctggaaatccaagatcgagtaccccgccgagacgccgcgcatc
gtctgctgcggcatcatcaaccgcggcgccgcgctctacgacggcaaggtgttccgcacc
accctcgacgccaacgtgatcgcgctcgacgccaaggacggcaaggagctttggcggcag
aaggcggccgatatcaaggaaggctattcgatgacggtggccccgctggtcgccgacggc
gtcgtcatcaccggcatctccggcgccgagttcggcacccgcggcttcatcgacggctgg
gatccggcgacgggcaagcatctctggcgcacccattcgatcccctctcccgacgagccc
ggtggcgacacctggaagggcgacacctggaagctcggcggcggctcgacctggatcacc
ggctcctacgatcccgagctgaacacggtctattggggcatcggcaatcccggcccgttc
aactcggcggtgcgccccggcgacaacctctacacctgctccgtgctggcgatggatccc
aagaccggcaagatcaagtggcactaccagttctcgccgaacaatccgttcgactatgac
agcgtggccgagatggtcctcgccgacatgaacgtcgagggcaagccgaccaaggtgctg
atggatgccaaccgtaacggcttcttctacgtgctcgaccgcaccaacggaaagctgctc
gcggccaatccctacgtgaaggtgaactgggcgaccggcgtcgacatgaagacgggccgc
ccgatcgagaccgacgtttcgaaggacgcccgcgagggcaagaaggtgactgtctatccg
tcgatcctcggcggcaagaactgggagccgatgtcgttcaatccgcaaaccggattggcc
tacgccaacacgctcgccttcggcggcaagtacaaggccgaaccggtcaccttcaagcag
ggcgaatggtatctcggcatggacctcaccgatccctgggaattcggcgacggcgcgcgg
ggccatctgaaggcgatcgatccgatgaccggcaaggcgaagtgggaggcgcccgccgac
atcccgcgcttctccggcgtgctgtcgaccgcgggcggcgtcgtgttcacgggcgccctg
accggcgagttcgaggccttcgatgccgacaccggcaagaagctctggcagttccagacc
ggctccggcatcgagggacaaccggtgacgtggcagcaggatgacgtgcaatacatcgcc
gtcaccagcggctacggcggcgtctactcgctgttctccggcgacgagcggctcgccaag
gtgccgcccggcggctcgctgtgggtctttgcggtcaagcaatag

DBGET integrated database retrieval system