KEGG   Bradyrhizobium diazoefficiens USDA 110: blr6298Help
Entry
blr6298           CDS       T00109                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    blr6298 (asnB)
Enzymes [BR:bja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     blr6298 (asnB)
Peptidases [BR:bja01002]
 Cysteine Peptidases
  Family C44
   blr6298 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6932928..6934805
Genome map
AA seq 625 aa AA seqDB search
MCGIFGWVLAAAKHQNRDTLIGLTDLMSHRGPDASGYWLHQTSDERYQIGFGHRRLSIID
IGGGAQPMATEDGRFNLVFNGEIYNYLELRKELVALGHHFRTDSDTEVLIEAYRAWQLDA
VRRLRGMFAFALWDDAEQRLVLARDAFGKKPLFLAEAQGAVLFGSEIEPLVQFPGFSRAL
DSDAIGHYLLNRYVPGPSTFFQSVKKLQPGHCAVWQNGMLKSTRYYTPPFATTVPDVKDF
NSAIRLFEGAFDEAVRIRMRSDAPYGAYLSGGIDSSAVVATMVKHSTEPVRTFSVGFRET
GYSELDHARVIAGQFGTIHNDLIVEPSAFMDHWSTAALRRGAPVSEASDIPIFMLSEMAS
RSVKMVLTGEGADELMGGYPKYRAERWIGLYQWLIPHLLHERLIHPLVRSLPYGMRRAKI
VALAAGERDLANRMRVWFGGLSVGESEAMLGRLLSATPPDLFPYSSQIGSSLRRTLFFDQ
TSWLPDNLLERGDRMMMAGSIEGRMPFMDTVLAGVVARFPDDFLTGGKGGKRVLRAAMDK
ILPSEIIRRKKIGFRVPIGEWFRGPYREFLRDMLVSETSAVAQMVRGDRLRQLVTEHLDA
RQNHERLLWSFVNLEIFVRAFRVAS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatatttgggtgggttctagccgccgcgaagcatcagaatcgcgacaccctc
atcggcctcaccgatttgatgtctcatcgcgggcccgacgcttcgggctactggcttcac
cagacttccgacgagcgatatcaaatcggctttggccaccgccggctttccatcatcgac
atcggtggcggcgcccaaccgatggcgacggaggatggccgcttcaacttagttttcaat
ggcgagatctataattaccttgagctgcggaaggagctcgttgctcttggccatcacttt
cgtacggactcggataccgaggtgctgatcgaggcatatcgggcctggcagctcgacgcg
gtgcgcagattgcgcggcatgttcgcctttgcactgtgggacgacgctgagcagcggtta
gtacttgcccgcgatgccttcggcaagaagccactgtttctcgccgaggcgcaaggggct
gttctcttcggctcagagattgagccgctcgttcagttcccgggcttcagccgcgcctta
gattccgatgcgatcggccactatcttcttaatcgctatgttccggggccatcgacgttt
tttcagtcggtgaagaagctgcagcctggtcattgtgcggtatggcaaaatggcatgttg
aagtcgacacgctattatacgccgccgttcgcgacgacggtgccggacgtcaaggatttc
aacagcgcaattcgattattcgaaggtgcgttcgacgaggccgtccgaattcgcatgcgc
agcgacgcgccgtacggcgcttatctttcgggcggcatcgactcgtcggcggtcgtggcg
accatggtcaaacacagtacggagccggtgcggacgttctcggtaggctttcgggagacc
ggatattcggaactcgatcacgcgcgggtcattgcaggtcagttcggcactattcacaat
gatctcattgtcgagcctagcgcgttcatggaccattggtcgaccgccgccctgcgtcgc
ggcgctccggtgagcgaggcgtctgacatcccgattttcatgctttcggaaatggcttcg
cgtagcgtgaagatggtacttacgggagaaggcgccgatgagctgatgggcggatatccg
aagtatcgggccgagcgatggatcggcctctatcaatggctcatcccgcacctgttgcac
gagcggctgatccatccgctagtccgctcgctgccgtatggcatgaggcgtgcaaaaatt
gttgcgctggcagcaggcgagcgcgatctcgcaaaccgtatgagagtatggttcggcggc
ctttcggtcggcgaaagtgaagcaatgctggggcgactgctttcagcaaccccgcccgac
ctgtttccgtattcgtcgcagattggatccagcctgcgacgtacgttgttcttcgatcag
acgtcttggcttccggataaccttttggaacgcggcgatcgaatgatgatggcgggatca
atcgagggccggatgccgtttatggatacggtgctggcgggcgtcgtggctagattcccg
gacgactttctgaccggaggcaagggaggaaagagagtcttgcgggcggcgatggacaag
attctgccgtcggaaatcatacggcggaagaagatcggcttccgggtgccaatcggggaa
tggttccggggtccctatcgtgagttcttgcgggacatgctggtgagcgaaacgtccgcc
gtggcacaaatggtacgcggcgacaggctccgtcagcttgtgacggagcaccttgacgct
cgacagaaccacgaaagacttctttggtcgttcgtgaatctcgagatcttcgtgcgtgcg
ttcagggtggcatcatga

DBGET integrated database retrieval system