KEGG   Bradyrhizobium japonicum USDA110: blr6564Help
Entry
blr6564           CDS       T00109                                 

Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bja  Bradyrhizobium japonicum USDA110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
7229828..7230859
Genome map
AA seq 343 aa AA seqDB search
MALVLVTGGSGFIGHHLVESLRARGQRVRVLDVRPPAAANTDVDYVHGSVLDGAAVDAAL
AGVDQVYHLAGLPGMWVANKQDFHDVNFRGTEVVLAAAMKRGVSRFLHCSTESILFPYTD
LDGAPAEEALQPADAMPGAYTRSKSLAEHHAAKAAASGFPLVIGTPTMPIGVADHNLTPP
TAMLWYFLQKKVQPHLNFLVNLVDVRDVAMGLVLTMERGRIGQRYILGGDCVPLGRILRM
MSAMSGRRQFPIVVPGKIAELSGIMLEYLSDNFTRRPPNGTAEGVRIALAASDLSIGKAR
TELGYSPRPIEPVLRETITHLLARGGVQPSGAIKQHALSSRAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgtactggttaccggtggcagcggcttcatcggacatcatctcgtagaatcg
ctccgcgcccgtgggcagcgggtgcgtgttctcgatgtccggccgccggccgccgccaat
accgacgtcgactatgttcacggctcggtgctggacggcgccgcggtcgatgccgcgctg
gccggcgtcgatcaggtctatcacctcgccggcctgcccggcatgtgggttgccaacaag
caggactttcacgacgtcaatttccgcggcaccgaggtcgtgctggcggctgcgatgaag
cgcggcgtgtcgcgcttcctgcactgctcgacggaatcgatcctgttcccctataccgac
ctcgacggcgctccagccgaagaggcgctccagccggccgacgcgatgcccggcgcctat
acgcggtcgaagtcgctcgccgagcatcacgccgcgaaggccgcggccagtggctttccg
ctcgtgatcggcacgccgaccatgccgatcggagttgccgaccacaacctgacgccgccg
acggcgatgctctggtacttcctccagaagaaagtgcagccgcacctcaacttcctggtc
aatctcgtcgatgtccgcgacgtcgccatgggcctcgtgctgaccatggagcgcggccgc
atcggccagcgctacatcctcggcggcgactgcgtcccgctcggccgcatcctgcggatg
atgtcggcgatgagcggccgccgccagttcccgatcgttgtgcctggcaagatcgctgag
ctctccggcatcatgctcgaatatctatccgacaacttcacgcgccggccgcccaacggc
accgccgagggcgtgcgcattgcgctcgccgcgagcgatctctcgatcggcaaggcgcga
accgagctcggctactcgccgcgcccgatcgagccggtcctgcgcgaaaccatcacccat
ctgctcgcccgcggcggcgtgcagccctccggcgccatcaagcaacacgcgctctcctcg
cgcgctggctaa

DBGET integrated database retrieval system