KEGG   Bradyrhizobium diazoefficiens USDA 110: blr6564Help
Entry
blr6564           CDS       T00109                                 

Definition
(RefSeq) dihydroflavonol-4-reductase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     blr6564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 RmlD_sub_bind NmrA adh_short KR
Motif
Other DBs
NCBI-GeneID: 1054422
NCBI-ProteinID: NP_773204
RhizoBase: blr6564
UniProt: Q89FY4
Position
7229828..7230859
Genome map
AA seq 343 aa AA seqDB search
MALVLVTGGSGFIGHHLVESLRARGQRVRVLDVRPPAAANTDVDYVHGSVLDGAAVDAAL
AGVDQVYHLAGLPGMWVANKQDFHDVNFRGTEVVLAAAMKRGVSRFLHCSTESILFPYTD
LDGAPAEEALQPADAMPGAYTRSKSLAEHHAAKAAASGFPLVIGTPTMPIGVADHNLTPP
TAMLWYFLQKKVQPHLNFLVNLVDVRDVAMGLVLTMERGRIGQRYILGGDCVPLGRILRM
MSAMSGRRQFPIVVPGKIAELSGIMLEYLSDNFTRRPPNGTAEGVRIALAASDLSIGKAR
TELGYSPRPIEPVLRETITHLLARGGVQPSGAIKQHALSSRAG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgtactggttaccggtggcagcggcttcatcggacatcatctcgtagaatcg
ctccgcgcccgtgggcagcgggtgcgtgttctcgatgtccggccgccggccgccgccaat
accgacgtcgactatgttcacggctcggtgctggacggcgccgcggtcgatgccgcgctg
gccggcgtcgatcaggtctatcacctcgccggcctgcccggcatgtgggttgccaacaag
caggactttcacgacgtcaatttccgcggcaccgaggtcgtgctggcggctgcgatgaag
cgcggcgtgtcgcgcttcctgcactgctcgacggaatcgatcctgttcccctataccgac
ctcgacggcgctccagccgaagaggcgctccagccggccgacgcgatgcccggcgcctat
acgcggtcgaagtcgctcgccgagcatcacgccgcgaaggccgcggccagtggctttccg
ctcgtgatcggcacgccgaccatgccgatcggagttgccgaccacaacctgacgccgccg
acggcgatgctctggtacttcctccagaagaaagtgcagccgcacctcaacttcctggtc
aatctcgtcgatgtccgcgacgtcgccatgggcctcgtgctgaccatggagcgcggccgc
atcggccagcgctacatcctcggcggcgactgcgtcccgctcggccgcatcctgcggatg
atgtcggcgatgagcggccgccgccagttcccgatcgttgtgcctggcaagatcgctgag
ctctccggcatcatgctcgaatatctatccgacaacttcacgcgccggccgcccaacggc
accgccgagggcgtgcgcattgcgctcgccgcgagcgatctctcgatcggcaaggcgcga
accgagctcggctactcgccgcgcccgatcgagccggtcctgcgcgaaaccatcacccat
ctgctcgcccgcggcggcgtgcagccctccggcgccatcaagcaacacgcgctctcctcg
cgcgctggctaa

DBGET integrated database retrieval system