KEGG   Bradyrhizobium diazoefficiens USDA 110: blr6637Help
Entry
blr6637           CDS       T00109                                 

Definition
(RefSeq) cytochrome C
  KO
K08738  cytochrome c
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    blr6637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Haem_bd
Motif
Other DBs
NCBI-GeneID: 1054107
NCBI-ProteinID: NP_773277
RhizoBase: blr6637
UniProt: Q89FR2
Position
7313743..7314168
Genome map
AA seq 141 aa AA seqDB search
MEAQMQSRLQTSPSRWLHPIAGALTLLLSAPSSLAQQPANDEVAQQAFNNSCRTCHSVKE
GDNRLGPNLSKIVGRKAGSLPDYNYSPSMKEAGFVWDQDKLTRFMVKPDEVVSGNKMQPY
GGVSAEEAAKVLAYLQAAGAQ
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcagatgcaatcccgcctgcaaacctcgccgagccgatggctgcacccgatc
gccggcgcattgacgctgctcctgtccgcgccgtcttcgctcgcccagcagccggcgaac
gacgaggtagctcagcaggcgttcaacaattcctgccgcacctgccactcggtgaaggag
ggcgacaatcgtctgggccccaatctcagcaagattgtgggacggaaggcaggctcgctg
cccgactacaactactctccgtcgatgaaggaagccggcttcgtctgggaccaggacaag
ctcacccgcttcatggtcaagccagatgaagttgtctccggcaacaagatgcagccctat
ggcggcgtctccgcggaagaagcggccaaggtgcttgcgtatctgcaggcggcgggcgcg
caatag

DBGET integrated database retrieval system