KEGG   Bradyrhizobium diazoefficiens USDA 110: blr7268Help
Entry
blr7268           CDS       T00109                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00071  Fatty acid degradation
bja00280  Valine, leucine and isoleucine degradation
bja00281  Geraniol degradation
bja00310  Lysine degradation
bja00360  Phenylalanine metabolism
bja00362  Benzoate degradation
bja00380  Tryptophan metabolism
bja00410  beta-Alanine metabolism
bja00627  Aminobenzoate degradation
bja00640  Propanoate metabolism
bja00650  Butanoate metabolism
bja00903  Limonene and pinene degradation
bja00930  Caprolactam degradation
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    blr7268
   00650 Butanoate metabolism
    blr7268
  Lipid metabolism
   00071 Fatty acid degradation
    blr7268
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    blr7268
   00310 Lysine degradation
    blr7268
   00360 Phenylalanine metabolism
    blr7268
   00380 Tryptophan metabolism
    blr7268
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    blr7268
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    blr7268
   00281 Geraniol degradation
    blr7268
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    blr7268
   00627 Aminobenzoate degradation
    blr7268
   00930 Caprolactam degradation
    blr7268
Enzymes [BR:bja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     blr7268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 1048473
NCBI-ProteinID: NP_773908
RhizoBase: blr7268
UniProt: Q89E19
Position
7996152..7997132
Genome map
AA seq 326 aa AA seqDB search
MTATSICAPHRQPIDASPLPITGQHSQLNETIRPNGNARGNAMSSFETILVERPEPAIAR
VVMNRPDARNAQNLQMTYDLNAAFDAAVQDDTVKVIILAGNGPHFSSGHDLRPGGKNEAG
VDFPPIGNWGGFAEANAHGRFAREQEIYLQITRRWRNLAKPVIAEVHGKCIAGGLMLAWA
CDLIVASDDAQFCDPVVAMGVCGVEWFVHPWELGPRKAKEFLFTADSWSAQEAHQLGMVN
QVVPRAELSSRVLELARRIASKPSFALKLTKEAVNRSVDVMGQPAAIDQAFALHQLCHAH
NLQEFGMIVDPSGLHPSVRKPPAAAE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaacaagcatatgcgcgccccatcgccagccgattgacgcaagccccttgcct
atcaccggccaacatagtcaactcaacgaaacaataagaccaaacggaaacgccaggggg
aacgcgatgtcctcgttcgagaccatcctcgtggagcggccggagccggcgattgcccgg
gtcgtcatgaaccggcccgatgcgcgcaacgcgcagaacctgcaaatgacctacgacctc
aacgctgccttcgatgccgcggtgcaggacgacacggtcaaggtgatcatccttgccggc
aacgggccgcatttctcctcgggccacgatttgcgcccgggcggcaagaatgaagcgggc
gtcgattttccgccgatcggaaattggggcggcttcgccgaagccaacgcgcacggccgc
ttcgcgcgcgagcaggaaatatatctccagatcacgcgccgttggcgcaatctggcaaag
cctgttatcgccgaggtgcacggcaagtgcatcgccggcggcttgatgctggcctgggcc
tgcgacctcatcgtcgccagcgacgatgcgcagttctgcgatcccgtggtcgccatgggc
gtctgcggcgtcgaatggttcgtgcatccttgggagctcgggccgcgcaaggccaaggaa
ttcctgttcacggccgacagctggagcgcgcaggaggcgcatcagctcggcatggtcaat
caggtcgtgccacgcgcggagttgtcatcgcgcgtgctggagctggcgcgccggatcgca
tcaaagccgtccttcgcgctgaagctgaccaaggaggcggtcaatcgttcggtcgatgtg
atgggccagccggctgcaattgaccaggcctttgccctgcatcagctctgtcacgcccat
aaccttcaggagttcggcatgatcgtcgatccatcgggcctgcatccctccgtgcgcaaa
ccgccggcggccgcggagtag

DBGET integrated database retrieval system