KEGG   Bradyrhizobium japonicum USDA110: blr7488Help
Entry
blr7488           CDS       T00109                                 

Gene name
cyc1
Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bja00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bja02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
8224279..8224683
Genome map
AA seq 134 aa AA seqDB search
MGELLAMRAVVLGLCTAVVLVVRVADAQMPLPAAKPPDGATLFKQQCAVCHTLSLSEPLR
QGPPLVKIVGRTAGKVDGFRYSDGLAKADFAWDETRLDAWLTNPQAVIPGVVMAYRQGKP
ETRAAIITYLKELN
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagctcttggcaatgcgcgcagtcgtgctgggattgtgcaccgcagtggtgctg
gtggtgcgggttgccgacgcgcagatgcccttgccggccgcaaagccgccggacggcgcg
acactgttcaagcagcaatgcgcggtgtgtcacactttgagcctgtcggaaccgttgcgg
caaggtccgccgctggtcaagatcgtgggccggaccgccggcaaggtcgacggcttccgc
tattcggacggcctcgccaaagccgacttcgcctgggacgagacccggctcgatgcgtgg
ctgaccaatccgcaagccgtcattcccggcgtggtcatggcctaccggcagggtaagccg
gagacgcgcgccgccatcatcacctacctcaaggagctgaactga

DBGET integrated database retrieval system