KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8106Help
Entry
blr8106           CDS       T00109                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00300  Lysine biosynthesis
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
bja01230  Biosynthesis of amino acids
Module
bja_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    blr8106 (dapE)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     blr8106 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 1049065
NCBI-ProteinID: NP_774746
RhizoBase: blr8106
UniProt: Q89BP2
Position
8898366..8899532
Genome map
AA seq 388 aa AA seqDB search
MTDALSIARDLIRCPSVTPADAGALGVLENALNAAGFTCHRVTFSEPGTADVDNLYARIG
SEGPHITFAGHTDVVPAGDESAWSVGAFSGEVKDGFLHGRGAVDMKGGIACSVAAVLEHL
AANGGKPRGDGTGSISFLITGDEEDVSINGTIKLLKWAAERGETFDHCVLGEPSNVETLG
DTIKVGRRGSQSGTLYVDGVQGHVAYPHRASNPVPDISRLIVAISDEPLDHGSAQFQASN
LEFTSVDVGNKANNVIPGEARAKFNIRYNDNHTQASLRELVETRLAKACGNRIKARIVWE
PSNSNVFVTKPGPFTDLAVSAIEEITGRKPELSTSGGTSDARFISSYCPVIEFGLVGQTM
HQVDERVPVKDLEKLTQVYRGILTRYFG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgctctctcgattgcccgcgatctcatccgctgcccctcggtaaccccggcc
gatgccggcgcactcggggtgcttgaaaacgccctcaacgccgccggcttcacctgccac
cgcgtgacgttcagcgagcccggcaccgccgacgtcgacaatctctatgcgcggatcggc
agcgaagggccgcacatcaccttcgccggccacaccgacgtggtgccggctggcgacgag
agcgcctggagcgtcggcgcattctccggcgaggtgaaggacggttttctgcacggccgc
ggcgcggtcgacatgaagggcggcatcgcctgctcggtcgcagccgtgctggagcatctc
gccgccaacggcggcaagccgcgcggcgacggcacgggttcgatctcgttcctgatcacc
ggcgacgaggaagacgtctccatcaacggcaccatcaaacttctgaagtgggccgccgag
cgcggcgaaacattcgatcattgcgtgctgggcgagccctccaatgtcgagacgctcggc
gacaccatcaaggtcggccgacgcggctcgcaatccggcacgctgtatgtcgacggcgtg
cagggccatgtcgcctatccgcaccgcgcctccaatccggtgccggacatttcgcgattg
atcgtggcgatctccgacgagccgctcgaccacggcagcgcgcagttccaggcgtccaac
ctcgaattcacctcggtcgacgtcggcaacaaggccaacaacgtcatccccggcgaggcc
cgcgcaaaattcaacatccgctacaacgacaaccacacccaggcgagcctgcgcgagctg
gtcgaaacacggctggcaaaagcctgcggcaaccgcatcaaggcccgcatcgtctgggag
ccgtcgaactcgaacgtgttcgtgaccaagcccggcccgttcaccgatctcgcggtgtcc
gcgatcgaggagatcacggggcggaagccggagctgtcgacgagcggcggcacctcggac
gcgcgcttcatctccagctattgcccggtgatcgagttcggtctggtgggacagaccatg
caccaggtcgacgagcgcgtgccggtgaaggatctggagaagctgacgcaggtgtatcgg
gggatactgacgcggtattttgggtga

DBGET integrated database retrieval system