KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8118Help
Entry
blr8118           CDS       T00109                                 

Definition
(RefSeq) ABC transporter permease
  KO
K02029  
polar amino acid transport system permease protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Module
Putative polar amino acid transport system
Brite
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    blr8118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8910315..8910977
Genome map
AA seq 220 aa AA seqDB search
MYHWDFGILWSYRWLFLNGLGVTVGFTVVIVVLGLVFGLFGAFGSLSRLKAVRLVALTFI
EAFRCTPILVQLIWFYYALPILAGVEMTPITASALALSLYGGSFYSEIIRGGIVSIDKGQ
SEAGAALGMTPGQAMRRIVLPQAIKRMIPALMNQSIIQFKNTSLVSVLAVPDLVYQSQVA
AHDSYRPLETYTAVAVAYAAILIPLTIIVRRGEKRLAVGE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtatcactgggacttcggcattctctggagctatcgctggctctttctcaacgggctc
ggcgtcaccgtcggcttcaccgtggtcatcgtggtgctcggactggtgttcggcctgttc
ggcgcattcggcagcctgtcgcgtctcaaggcggtgcgcctcgtcgccctcaccttcatc
gaggcgttccgctgcacgccgattctggtgcagctgatctggttctattacgcgctgccg
atcctcgccggcgtcgagatgacgccgatcacggcctcggcgctggcgctgtcgctctat
ggcggctcgttctattcggagatcatccgcggcggcatcgtctcgatcgacaagggccag
tccgaagcgggtgccgcgctcggcatgacccctggccaggcgatgcggcgcatcgtgctg
ccgcaggcgatcaagcgcatgatcccggcgctgatgaaccagtcgatcatccagttcaag
aacacctcgctggtctcggtgctggcggtgcctgacctcgtctatcagagccaggtcgcg
gcccatgacagctaccggccgctggagacctacacggcggtcgcggtcgcctatgccgca
atcctgattccgctcaccatcatcgtccggcgcggcgagaagcgattggcggtcggcgaa
tga

DBGET integrated database retrieval system