KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8119Help
Entry
blr8119           CDS       T00109                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02028  
polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Module
Putative polar amino acid transport system
Brite
Enzymes [BR:bja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     blr8119
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    blr8119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8910974..8911768
Genome map
AA seq 264 aa AA seqDB search
MSDTSKIEIRALRKSFGSNEVLKNISLDVAKGGVVALIGPSGSGKSTLLRCVNLLVTPDG
GSVRVGDTRFQFGEGAKLPDVKTLARFRATTGMVFQHFNLFPHMTTLQNVMEGPVTVRRM
ARADAEKLARAQLAKVGLAEKADQYPATLSGGQKQRVAIARALAMEPDVMLFDEATSALD
PELVGEVLAVMQRLASEGMTMVIVTHEIAFAREVADRLIFMRDGVVVEEGPARQVIDNPQ
EAATRAFLSHFHRTGALPPANATS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacttcgaagatcgagatccgcgccttgcgcaagagcttcggcagcaacgag
gtcctgaagaacatcagcctcgacgtcgccaagggcggcgtggtggcgctgatcggcccg
tctggctcgggcaagtcgacgctgctccgctgcgtcaatcttctggtgacgcctgatggc
ggcagcgttcgcgtcggcgatacacgcttccagttcggcgagggcgcaaagctgcccgac
gtgaagacactcgcaagattccgcgccaccaccggcatggtgttccagcacttcaacctg
ttcccgcacatgaccacgctccagaacgtgatggagggaccggtcacggtgcgccgcatg
gccagggccgacgccgagaagctcgcgcgggcgcagctcgcaaaggtcggccttgccgag
aaggcggaccagtatccggcgacgctctcgggcggacagaagcagcgcgtcgcgatcgcg
cgggcgctggcgatggagccggacgtgatgctgttcgacgaggccacctcggcgctcgac
cctgaactcgtcggcgaggtgctcgccgtcatgcagcggctggcctcggagggcatgacc
atggtgatcgtgacccatgagatcgcctttgcccgcgaggtcgccgaccgcctcatcttc
atgcgcgacggtgtcgtcgtcgaggaaggcccggcgcggcaggtgatcgacaatccccag
gaagccgcgacgcgtgccttcctcagccatttccaccgcaccggcgcgctgccgccggcc
aacgcaacatcctga

DBGET integrated database retrieval system