KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8131Help
Entry
blr8131           CDS       T00109                                 

Gene name
polA
Definition
(RefSeq) DNA polymerase I
  KO
K02335  
DNA polymerase I [EC:2.7.7.7]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    blr8131 (polA)
   00240 Pyrimidine metabolism
    blr8131 (polA)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    blr8131 (polA)
   03410 Base excision repair
    blr8131 (polA)
   03420 Nucleotide excision repair
    blr8131 (polA)
   03440 Homologous recombination
    blr8131 (polA)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     blr8131 (polA)
DNA replication proteins [BR:bja03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     blr8131 (polA)
DNA repair and recombination proteins [BR:bja03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     blr8131 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     blr8131 (polA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8924702..8927773
Genome map
AA seq 1023 aa AA seqDB search
MPKTSPKTTAKADTKAAAPKTAADSKSAATTAAKPVAAKAAGKGDHVFLVDGSSYIFRAY
HALPPLNRKSDGLQVNAVLGFCNMLWKLLRDMPADNRPTHLAIVFDKSEVTFRNKIYPEY
KAHRPPAPDDLIPQFALIREAVRAFDLPCLEQGGFEADDLIATYAREASDRGATTTIVSS
DKDLMQLVNDRITMYDTMKDRRIGIPEVIEKFGVPPEKVVEVQALAGDSTDNVPGVPGIG
IKTAAQLIVDYGDLEQLLFRATEIKQPKRREALIENAEKARISRKLVLLDDKVELEVPLD
DLAVHEPDARKLIAFLKAMEFSTLTRRVADYSQIDPANVDADVANSSEARGGDSAARTTS
SATSGDLFAAPAVTATGGDKGGKSASIKGAPISLAAAREEALRKLPVDRGKYQAIKTLAE
LNAFIARIHDAGHVAIEIRANSIDPMQADLCGVALSLAPNDACYVPLAHKQSGGGAGLFD
GGLAPDQVKHADAIDALRPVLESSGILKIGFDVKFTAVMLAQHGITLRNTDDAQLISYVL
DAGRGSHGLESLAERWFGHAMLKEGELLGSGKGKITFDQVPIDKAAPLSAEGADMALRVW
RVLKPRLVAEHMTTVYETLERPLVAVLARMERRGISIDRQVLSRLSGDFAQTAARVEAEI
QEIAGEPVNVGSPKQIGDILFGKMSLPGGTKTKTGAWSTTAQVLDELAEQGHDLPKKILE
WRQVSKLKSTYTDALPEYVNPQTHRVHTTYALAATTTGRLSSNEPNLQNIPVRTEDGRKI
RRAFIATPGHKLVSADYSQIELRLLAEIADIPVLKQAFRDGLDIHAMTASEMFGVPIKGM
PSEIRRRAKAINFGIIYGISAFGLANQLGIAREEASAYIKKYFERFPGIRAYMDETRDFC
RQHGYVTTLFGRKCHYPDIKASNASVRAFNERAAINARLQGTAADIIRRAMTRVEDALAE
KKLSAQMLLQVHDELIFEVPDAEVEATLPVVQHVMQDAPFPAVLLSVPLHVDARAAKNWD
EAH
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagacatccccgaagaccaccgccaaagctgacaccaaggctgccgcgcccaag
acggccgccgacagcaaatccgctgcgacaactgctgccaaaccggtggcggcgaaggcg
gccggcaagggcgaccatgtcttcctggtcgacggttcctcctacatcttccgcgcctat
cacgcgctgccgccgctgaaccgcaaatccgacggtcttcaggtcaatgccgtgctcggc
ttctgcaacatgctgtggaagcttttgcgcgacatgccagccgacaaccggccgacgcat
ctggccatcgtgttcgacaagtcggaggtcaccttccgcaacaagatctaccccgagtac
aaggcgcaccggccgccggcgcctgacgatctgatcccgcaattcgcgctgatccgcgag
gccgtgcgcgccttcgacctgccctgcctggaacaaggcggcttcgaggccgacgatctg
atcgcgacctatgcgcgggaggcgagcgaccgcggtgccaccacgaccatcgtgtcctcc
gacaaggacttgatgcagctcgtgaacgacaggatcacgatgtacgacaccatgaaggat
cgccgcatcggcattcccgaggtgatcgagaaatttggcgttccgccggagaaggtggtc
gaggtgcaggcgctcgccggcgattccaccgacaacgtgcccggcgtgcccggcatcggc
atcaagaccgcggcgcagctgatcgtcgattatggcgacctcgagcagctcctgttccgc
gcgaccgaaatcaagcagccgaagcggcgcgaggcgctgatcgagaatgccgagaaggcg
cggatctcgcgcaagctggtgctgctcgacgacaaggtcgagctggaggtgccgctcgac
gacctcgccgtccacgagcccgacgcgcgcaagctgatcgccttcctgaaggcgatggag
ttctccacgctgacgcgccgcgtcgccgactattcgcagatcgatcccgccaatgtcgat
gccgatgtggcgaacagcagcgaggcccgcggcggcgacagcgcggccaggacgacctcg
tccgcgacgtccggcgatctcttcgccgctcctgcggttacggcaacgggcggcgacaaa
ggcggcaagtcggccagcatcaagggcgcgccgatctcgctcgccgccgcgcgcgaagag
gcgctgcgcaagcttccggtcgaccgcggcaagtaccaggcgatcaagacgctcgccgaa
ttgaacgccttcatcgcgcgcattcacgatgccggccatgtcgcgatcgagatcagggcg
aactcgatcgatccgatgcaggccgatctctgtggcgtcgcgctgtcgctcgcgccgaac
gatgcgtgttacgtgccgctggcgcacaagcagtccggcggcggcgccggcctgttcgac
ggcggccttgcgcccgatcaggtcaagcatgccgacgcgatcgacgcgttgcggccggtg
ctggaatcatcgggcatcctcaagatcggcttcgacgtcaaattcaccgccgtcatgctg
gcgcagcacggcatcaccttgcgcaacaccgacgacgcccagctgatctcttatgtgctc
gacgccggccgcggctcgcacgggctggaatcgctcgccgagcgctggttcggccacgcc
atgctgaaggagggcgagttgctcggcagcggcaagggcaagatcaccttcgaccaggtg
ccgatcgacaaggccgcgccgctgtcagcggaaggcgccgacatggccttgcgggtctgg
cgcgtgctgaagccgcgcctcgtcgccgagcacatgacgacggtctatgagacattggag
cggccgctggtcgcggtgctcgcgcgcatggagcggcgcggcatctcgatcgatcgccag
gtgctgtcgcgtctctccggcgacttcgcccagaccgcggcccgcgtcgaagccgagatc
caggagatcgcgggcgagccggtcaatgtcggcagccccaagcagatcggcgacatcctg
ttcggcaagatgagcctgccgggcggcaccaagaccaagaccggcgcatggtcgaccacc
gcgcaggtgctcgacgagctcgccgagcagggccacgaccttccgaaaaagattctggag
tggcgccaggtctcgaaactcaaatcgacctacaccgacgcgctgcctgaatacgtcaat
ccgcagacccatcgcgtgcacacgacctacgcgctggccgcgaccacgacgggccggctg
tcgtcgaacgagccgaacttgcagaacatcccggtgcgcaccgaggacggccgcaagatt
cgccgcgctttcatcgcgacgcccgggcacaagctcgtctccgccgactattcgcagatc
gaattgcggctgctggccgagatcgccgacatccccgtgctgaagcaggcgttccgcgac
gggctcgacattcacgccatgaccgcgtcggaaatgttcggcgtgccgatcaagggcatg
ccgagcgaaatccgccgccgggccaaagcgatcaatttcggcatcatctacggcatctcg
gcgttcggcctcgccaaccagctcggcatcgcgcgcgaggaggcctcggcctacatcaag
aagtatttcgagcgcttccccggcatccgcgcctatatggacgagacgcgcgatttctgc
cggcaacacggctatgtcaccacgctgttcggccgcaagtgccactatcctgatatcaag
gcgtcgaacgcctcggtgcgcgccttcaacgagcgcgccgcgatcaacgcgcgtcttcag
ggcaccgcagccgacatcatccgccgtgccatgacgcgggtggaggacgcactcgccgag
aagaaactctcggcgcagatgctgctccaggtgcatgacgaattgatcttcgaggtgccg
gacgccgaggtcgaggcgacgctgccggtcgtgcagcacgtcatgcaggacgcgccgttc
ccggccgtgctgctgtccgtgccgctgcacgtcgatgcacgcgccgcgaagaactgggac
gaggcgcattga

DBGET integrated database retrieval system