KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8146Help
Entry
blr8146           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpr_kinase_C AAA_16 AAA_29 AAA_33 Sigma54_activat DUF4332 RNA_helicase NACHT
Motif
Other DBs
NCBI-GeneID: 1048731
NCBI-ProteinID: NP_774786
RhizoBase: blr8146
UniProt: Q89BK2
Position
8944607..8945131
Genome map
AA seq 174 aa AA seqDB search
MSDGGPSVHASAVKVGNLAVLIRGPSGSGKSRLAFDLIMAGRAGVVERAVLVGDDRVHLA
TVGDEIEVRPAPPLAGLIEIRGLGIRRCDFVEHATVGLVVDLAAADAERLPPAESLKTSI
LGVEIPRIPVSRDYSPLPLVVAALTTTKSSSSVNPSGDCLKGNGNHMNPTIATE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggcgggcccagcgtgcacgcctccgcggtcaaggtcgggaatctggcagtg
ctgatccgcggaccgtcgggctccggcaagtcgcgccttgccttcgatttgatcatggcg
gggcgcgccggcgtggtcgaaagggccgttctggtcggtgatgaccgtgtccatctggcg
acagtcggcgacgaaattgaagtccgccccgcgccgccgctcgccggcctgatcgagatc
cggggcctcggaatccgccgctgcgacttcgtggagcatgcgaccgtcggcctcgtggtc
gatctggccgccgcggacgcggaacgcctgccgccggccgaatccctgaaaactagcatt
ttaggtgtcgaaataccgcgaatccctgttagccgcgattattcgcccctcccactggtt
gttgcggccttgaccactaccaagagttcatcttccgttaatccctcaggcgattgtttg
aagggaaatggtaaccatatgaaccccactatcgcgaccgaatag

DBGET integrated database retrieval system