KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8150Help
Entry
blr8150           CDS       T00109                                 

Gene name
lepA
Definition
(RefSeq) GTP-binding protein LepA
  KO
K03596  
GTP-binding protein LepA
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8947810..8949660
Genome map
AA seq 616 aa AA seqDB search
MVAARGCEWYPAPMTTVPISNIRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQV
LDSMDIERERGITIKAQTVRLAYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLL
VVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEPEKVKQQIEDVIGIDASDAVM
ISAKTGLGVPDVLEAIVTRLPPPKGDRDATLKALLVDSWYDVYLGVVVLIRVVDGVMKKG
SRVRMMGTGAAYDVERVGFFTPKMTQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKP
VTEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRC
GFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGTELEIHNPVDMPDVVKIEEIQ
EPWIEATILTPDEYLGSVLKLCQDRRGAQKELTYVGARAMVKYDLPLNEVVFDFYDRLKS
VSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIP
PHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGK
VDIPQEAFIAALKVDS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggttgccgcacggggatgtgagtggtatcccgcgcccatgacgaccgtccccatttcc
aacatccgcaatttctccatcgtcgcccatatcgaccatggcaaatcgacgctggccgac
cgcctgatccagatgaccggcggcctcaccgaccgcgaaatggcgggcaaggagcaggtg
ctcgattccatggatatcgagcgcgagcgcggcatcaccatcaaggcgcagacggttcgg
ctcgcctaccgcgccaaggacggcaaggactacatcttcaacctgatggacacgcccggc
catgtcgacttcgcctacgaagtctcgcggtcgctggcggcctgcgagggttccctgctg
gtggtcgacgccagccagggcgtcgaagctcagacgctcgccaacgtctaccaggcgctc
gacaacaatcacgagatcgttccggtcctgaacaaggtcgacctgccggccgccgaaccc
gagaaggtcaagcagcagatcgaggacgtcatcggcatcgacgcctcggacgcggtgatg
atctcggccaagaccggcctcggcgttcccgacgtgctggaagccatcgtcacccgcctg
ccgccgccgaagggcgatcgcgatgcgaccctgaaggcgctgctggtcgacagctggtac
gacgtctatctcggcgtcgtcgtgctgatccgcgtcgtcgacggcgtcatgaagaagggt
agccgcgtccgcatgatgggcacgggcgccgcctacgacgtcgagcgcgtcggcttcttc
acgccgaagatgacgcaggtcgacgagctcggccccggcgagatcggcttcatcaccgcc
gcgatcaaggaagtcgccgacacccgcgtcggcgacaccatcaccgacgacaggaagcct
gtcaccgaaatgctgccgggcttcaagccggcgatcccggtggtgttctgcggcctgttc
ccggtcgacgccgacgatttcgagacgctgcgcgccgcgatgggcaagctgcgcctcaac
gacgccagcttctcgttcgagatggaaacctccgcggcgctcggcttcggcttccgctgc
ggcttcctcggcctcttgcacctcgagatcatccaggagcggctgtcgcgcgagttcgat
ctcaacctgatcgcgaccgcgccgagcgtcatctacaagatgaagctgaccgacggcacc
gagctcgagatccacaatcccgtcgacatgcccgacgtggtcaagatcgaggagatccag
gagccctggatcgaggcgacgatcctcacgcccgacgaatatctcggcagcgtgctgaag
ctgtgccaggaccgccgcggcgcgcagaaggagctgacctatgtcggcgcccgcgcgatg
gtgaaatacgatctgccgctcaacgaagtggtgttcgacttctacgaccgcctcaagtcg
gtctccaagggctacgcctcgttcgactatcatctcaccgactacaagccggccgacctc
gtcaagatgcagatcctggtcaatgctgagccggtcgacgcactctcgatgctggtccac
cgcacccgcgccgaggggcgcggccgcgccatggtcgagaagatgaaggagctgatcccg
ccgcacatgttccagatcccgatccaggcggcgatcggcggcaaggtgatcgcccgcgag
acggtccgcgcgctgcgcaaggacgtcaccgcgaagtgctacggcggcgacatcacgcgc
aagcgcaagcttctggagaagcagaaggaaggcaagaagaagatgcggcagttcggcaag
gtcgacatcccgcaggaagccttcattgccgcgctgaaggtggatagctga

DBGET integrated database retrieval system