KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8162Help
Entry
blr8162           CDS       T00109                                 

Gene name
modC
Definition
(RefSeq) molybdenum ABC transporter ATP-binding protein
  KO
K02017  
molybdate transport system ATP-binding protein [EC:3.6.3.29]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
ABC transporters
Module
Molybdate transport system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    blr8162 (modC)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.29  molybdate-transporting ATPase
     blr8162 (modC)
Transporters [BR:bja02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    blr8162 (modC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8963563..8964225
Genome map
AA seq 220 aa AA seqDB search
MLRVDVEKQLGEFSLSASFTSEGRVIGLFGASGAGKTSLVNMIAGLLRPDRGTIVIDGET
VDDTAAGIHVPPWRRRIGYVFQDARLFPHLNVAQNLDYGRRMNRLAPDPAQHRRVIDLLD
IGALLDRRPGKLSGGERQRVALGRALLSKPRLLLLDEPLGALDEGRKLEILPYLVRLRDE
ANVPMVYVSHDVAELRQLATQIVMLKEGRVTSFGGVKVLT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggtcgatgtcgaaaagcagctcggcgagttctcgctgtccgcatccttcacc
agcgaaggccgcgtcatcggcctgttcggtgcgtcaggcgccggcaagacctcgctggtc
aacatgatcgccgggctcttgcggcccgaccgcggcaccatcgtgatcgacggcgagacc
gtggacgacaccgcggccggcattcatgtgccgccctggcgccgccgcatcggctatgtg
ttccaggacgcgcggctgttcccgcatctcaacgttgcgcagaatctcgactatggacga
cggatgaaccgccttgcgcccgatcctgcccagcacaggcgcgtcatcgacctgctcgac
atcggcgccttgcttgaccgccgtccgggaaaactctccggcggcgagcgccagcgcgtc
gcgctcggccgcgcgctgttgtccaaaccgcgcctgctgctgctcgacgagccgctcggc
gcgctcgacgaaggccgcaagctcgagatcctgccctatctggtgcggctgcgggatgag
gccaacgtccccatggtctatgtcagccacgacgtcgccgagttgcgccagctcgccacg
caaatcgtgatgctgaaagaggggcgcgtgacgtcgttcggcggggtgaaggtgctgacg
tga

DBGET integrated database retrieval system