KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8173Help
Entry
blr8173           CDS       T00109                                 

Gene name
radC
Definition
(RefSeq) DNA repair protein
  KO
K03630  
DNA repair protein RadC
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8974193..8974813
Genome map
AA seq 206 aa AA seqDB search
MPAKADHDKTKPEDAPHYHGHRERLRERFYSAGADALSDYELLEMALFPALPRRDTKPLA
KTLIKIFGSFAEVVHAPVARLREIDGIGESAIHQLKLIAAAAHRVAKGEVNSRNALSSWN
EVIDYCRTSIMVVAFADKEQFRLLFLDKRNQLIADEVQQTGTVDHTPVYPREVIKRALEL
SATALILVHNHPTTHPMITLDHVQYR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaaagccgaccacgacaagaccaagccggaggacgcgccgcactatcacggc
catcgcgagcggttgcgcgagcgcttttacagcgccggggcggatgcgctcagcgactac
gagcttttggagatggcgctgtttccggcgctgccgcggcgcgacaccaagccgctcgcg
aagacgctgatcaagattttcggctcgttcgccgaggtcgtgcacgcgccggtggcgcgc
ttgcgcgagatcgacggcatcggcgaatccgcgatccaccagctcaagctgatcgcagcc
gccgcgcatcgcgtcgccaagggcgaggtcaacagccgcaacgcgctgtcgtcctggaac
gaggtgatcgactattgccgcaccagcatcatggtggtggcctttgccgacaaggagcaa
ttccgtctgctcttcctcgacaagcgcaaccagctcatcgccgacgaggtgcagcagacc
ggcaccgtcgaccacaccccggtctatccgcgcgaggtgatcaagcgcgcgctggagctg
tcggcaaccgccttgatcctggtgcacaaccaccccactacccaccctatgatcacgttg
gatcacgttcaataccgatga

DBGET integrated database retrieval system