KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8174Help
Entry
blr8174           CDS       T00109                                 

Definition
(RefSeq) site-specific integrase/recombinase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
8974971..8976212
Genome map
AA seq 413 aa AA seqDB search
MPSLTDTAIRHALKRVELSQKQENLADGEGRGTGRLVLVLKPMPKRVTADWMAQQWRDGK
RTKKKLGAYPSISLAQAREIFKRDFADVIQKGRSIKIATDTRPGTVADLFEGYVAALKDA
SKPSWKETEKGLNKIADTLGRNRLAREIEAEEIIELIRPIYERGAKSMADHVRSYLHAAF
SWGMKSDNDYRQQSSRRFRLPFNPATGIPTEPKIQGTRWLDEDEFVQLYRWLESPDTPVH
PSYPRAVQLIMLTGQRVEEIARFHVNQWDASERIIDWSKTKNLQPHAVPVPLLAAELIEK
IKPNEYGWFFPSAKDPSKPVSHGTLYSFVWRQRDRGVIPYATNRDLRRTFKTLAGKAGVS
KEIRDRLQNHALQDVSSKHYDRWHYMIEKRAGMAKWDKFVRAMLAKKRLKEAA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcctgaccgacaccgcgatccgacatgcgttgaagcgggtggagctaagtcag
aaacaggaaaatctcgccgacggtgaagggcgcggcaccggccgcctcgtgcttgtcctc
aagcccatgccgaagcgcgtcaccgccgactggatggcgcagcaatggcgcgatgggaag
cggaccaagaagaagctcggggcttatccctccatatcgctcgcccaggcacgcgaaata
ttcaaacgcgacttcgccgacgtcatccagaagggtcgcagcatcaagatcgctaccgac
acgcgccccggcaccgtcgctgatctgttcgaaggctatgtcgccgcgctcaaggatgcg
agcaagccgtcctggaaggaaacggaaaaaggccttaacaagatcgccgacacgctcgga
cgcaaccgcctcgctcgcgagatcgaggccgaggaaatcatcgagctgatccgcccgatc
tacgagcgcggtgccaaatcaatggccgaccatgtgcgctcctatctccatgccgccttt
agctggggcatgaagtctgacaacgactatcggcagcagtcttccagacgctttcgactc
cctttcaatccggcaaccggcattcctaccgagcctaagatccagggcacgcgctggctt
gacgaagacgagtttgtgcaactctatcgctggctggagagccccgacacgccggtccac
ccctcctatccccgcgcggtgcaactcatcatgctgacagggcagcgcgtcgaggagatc
gcgcggtttcatgtcaatcaatgggacgccagtgagcgaatcatcgactggtcgaagacc
aagaacctccagccgcacgctgtcccagtgccattgcttgccgccgagctgatcgaaaag
atcaagccgaacgagtatggctggttcttcccctccgccaaggacccctcgaagcctgtc
agccacggcactctttatagctttgtttggcggcagcgagatcgcggcgtgattccatat
gcgacaaaccgcgatctccggcgcacgttcaagacgctcgccggcaaggcaggcgtgtcg
aaggaaatccgcgatcgcctccagaaccacgcgctacaggatgtcagctccaagcactac
gaccgctggcactatatgatcgagaaacgcgctggcatggcgaaatgggacaaattcgtg
cgcgccatgctggcgaagaagcgactgaaagaggccgcatga

DBGET integrated database retrieval system