KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8215Help
Entry
blr8215           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9012510..9012920
Genome map
AA seq 136 aa AA seqDB search
MLRIHLSGERGGGRGMRYPASEKAEIIQQVEQSHLPAKRTLDKLGIPRATFYRWYDRYRE
GGVEALADHRSRPDRVWNRIPDDVRGQIIDLALELPELSPRELAVRFTDERKYFVSEASV
YRLLKAELAPQIRTVA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcattcacctgtcgggtgagagagggggaggacgaggcatgaggtatcccgcc
tctgagaaggccgagatcatccagcaggtcgagcaatcgcatcttcccgccaagcgcacg
ctggacaagctcggtatcccgcgcgccacattctatcgctggtatgatcgctaccgcgag
ggaggcgttgaagcgctggccgatcaccggtctcgaccagaccgggtctggaatcgcatc
cccgacgatgtgcggggtcagatcatcgacctggcgttggagttgcctgagctgtcgcca
cgcgagctggccgtgcggttcaccgacgaacgaaagtactttgtatccgaggcctcggtc
taccggctgctgaaggcagagctggccccgcaaattcggacagtagcttga

DBGET integrated database retrieval system