KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8215Help
Entry
blr8215           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_32 HTH_28 HTH_23 HTH_29 LZ_Tnp_IS481 HTH_Tnp_1 DUF1153 CENP-B_N HTH_Tnp_IS630
Motif
Other DBs
NCBI-GeneID: 1048277
NCBI-ProteinID: NP_774855
RhizoBase: blr8215
UniProt: Q89BE0
Position
9012510..9012920
Genome map
AA seq 136 aa AA seqDB search
MLRIHLSGERGGGRGMRYPASEKAEIIQQVEQSHLPAKRTLDKLGIPRATFYRWYDRYRE
GGVEALADHRSRPDRVWNRIPDDVRGQIIDLALELPELSPRELAVRFTDERKYFVSEASV
YRLLKAELAPQIRTVA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcattcacctgtcgggtgagagagggggaggacgaggcatgaggtatcccgcc
tctgagaaggccgagatcatccagcaggtcgagcaatcgcatcttcccgccaagcgcacg
ctggacaagctcggtatcccgcgcgccacattctatcgctggtatgatcgctaccgcgag
ggaggcgttgaagcgctggccgatcaccggtctcgaccagaccgggtctggaatcgcatc
cccgacgatgtgcggggtcagatcatcgacctggcgttggagttgcctgagctgtcgcca
cgcgagctggccgtgcggttcaccgacgaacgaaagtactttgtatccgaggcctcggtc
taccggctgctgaaggcagagctggccccgcaaattcggacagtagcttga

DBGET integrated database retrieval system