KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8219Help
Entry
blr8219           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9014032..9015573
Genome map
AA seq 513 aa AA seqDB search
MPTQRLSMRRIKEVLRLEHFQGLPERAIARSVGVSNGVVHSYLSRARSAGLSWPLPEGMT
DEDLELLLFPAPRPASQSPQRPVPDWSYIDKELRRRNVTRRLLWEEYRAVNPDGFGYTWF
CTTYEAWKGRVRPSMRQIHLGGEKVFVDFAGDTIDIVDPLTGEVQPMKLFVAAMGASNYT
YAEACPSESLADWIRAHVNLFTFLSGAPTFVVCDNLKAAVSNPDRYDPGLNRTYAEMASH
YGTAILAARPRRPKDKAKVEVAVQIAQRWILARLRNQRFFSRAELNAAIKTLVDELNARQ
MRGFGSSRAELFAELDKPKLTPLPDQPYAFARWKRCRLAPDYHVEVDGHWYSAPYRLIGE
LVDARIDDRTVEIFHKGQRIASHARAPNRRGHTTIADHMPSAHRRYGEWTPAAVIAAGER
IGPSTAAFFQAVIDARPHPEQGFRTCLGILALVKSYGAERLDAACRRGILIKARSVASIR
SILQNGLDRTFFDESFEHQPLRHGNIRGRDYFH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcctacccagagattgtcgatgcgccggatcaaggaagtccttcggttagaacatttt
caaggcctgccagagcgggccatcgcgcggagcgtgggcgtcagcaacggcgttgtgcac
agctacctgagccgcgcccgctctgctgggttgagctggccgcttccggagggaatgacc
gatgaagacctggagcttttgcttttcccagccccacgaccagcgtctcagagcccgcag
cggccggtgcccgactggagctacatcgataaggagctccgccggcgcaacgtaacccgt
cgcctgctctgggaggagtatcgcgccgttaatcccgacggtttcgggtacacgtggttc
tgcactacctacgaggcctggaaggggcgggtccgaccttcgatgcggcagattcatctg
ggcggcgagaaggtgttcgtggatttcgccggcgacaccatcgacatcgtcgatcccctg
accggggaagtgcagccgatgaagctgttcgtcgcggcgatgggcgcttcgaactacacc
tacgccgaggcctgccccagcgagagcttggccgactggatccgggcccacgtcaacttg
ttcacgtttttgagcggtgcgccgacgttcgtggtctgcgacaacctcaaagccgccgtc
agcaaccccgaccgctacgatcccggcctcaatcgcacttatgccgagatggcgagccat
tacggcaccgccattctcgccgcacggccgcggcgcccaaaagacaaggcgaaggtcgag
gtcgcggtgcaaatcgcccagcgctggattctggcccggctgcgcaatcagcgcttcttt
tcccgggccgagctcaacgccgccatcaagacactcgtcgacgaactcaatgctcgtcaa
atgcgtggcttcggctcaagccgcgccgaactgtttgccgaactcgacaaacccaagcta
accccgctgccagatcagccttatgccttcgcacgctggaagcgctgccgcctcgctccc
gattatcatgtcgaggtcgacggccattggtactccgcgccgtatcgtctgattggcgag
ctggtcgatgcccgtatcgacgatcggacggtcgagatcttccacaagggccagcggatc
gccagccatgcccgcgcgcccaaccgacgcggacacaccaccatcgccgaccacatgccc
agcgcccatcgccgctacggcgaatggacccccgccgcggtgatcgccgccggcgagcgg
atcggtccttcgacagcagcgtttttccaggccgtgatcgacgcccggccccatccagaa
caaggctttcgaacctgccttggcattctggcgctcgtcaaaagctacggcgccgaacgc
ctcgacgcagcctgccggaggggcatcctcatcaaggcgcgctccgtcgcctcgattaga
tcgatcctccagaacggcctcgatcgcacgttcttcgacgaatctttcgagcaccagccc
ctgcgccacggcaacatccgcggacgcgactacttccactga

DBGET integrated database retrieval system