KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8233Help
Entry
blr8233           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9024866..9026317
Genome map
AA seq 483 aa AA seqDB search
MIPEAREVHLSRKDRKVLEACCRSPVTLQRDLKRARIVLLAADGRSTRSIAKEVGVQPRI
VSLWRHRYADHGLEGLQDKPRPGKQPIYTKTTDKRILKLLDKPPPQGFARWTGPLLAEAL
GDVDVQYVWRFLRSHKIDLVARKSWCESNDPNFTAKAADVVGLYVAPPAKAIVLCVDEKP
SIQALERAQGYLKLPNGRALTGQSHDYKRHGTTTLFAALEVATGKIIATHSKRRRRVEFL
DFMNSVTAAFPNRKLHVILDNLNTHKKNEDWLKAHPNVQFHFTPTSASWLNQVEVWFSLA
GAVAQRHLLHEPQAASGTHRCLRQRIQRQSRALRLDQEKGPSTPFQRPPYHSALIPGTRR
IARRGEHLRALSPRRHCRLDLLRLVQGVSRGRQAPPGRRHGTSCDLRRGEGPPPGGRRLE
GGRRRSDAGEPSAQKKYERRWGGRGMRYPASEKAEIHPFGRAIAPPAKRTLDKLGIPRAT
FYR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatacccgaagcaagagaagtccacctttcgaggaaagatcgcaaggtgcttgaggcg
tgctgtcgctcaccggtgacgttgcagcgcgatttgaagcgggcgcggatagttctgttg
gcggcggatgggcgcagcacccggtcgatcgccaaggaagttggggtccagccgcggatt
gtcagcctttggcggcatcgctatgccgaccatggccttgaagggctgcaagacaagccg
cggcctggcaagcagccgatctatacgaagacgaccgacaagcggattctgaagctgctg
gataagccgccaccgcaagggtttgcgcgctggaccggccccctgctggccgaggcgctg
ggcgatgtcgatgtccaatatgtctggcggttcctgcgcagccacaagattgacctggtg
gctcgcaagtcctggtgcgagagcaacgacccgaactttacggccaaagccgccgatgtt
gtcggcctctatgtcgcgccgccggcgaaggccattgtgctgtgcgtggacgagaagccc
tcgatccaggctttggagcgagcgcagggttatctgaagttgcccaatggccgcgccttg
accggccaaagccacgattacaagcggcatggcaccacaacattgtttgcggcgctcgaa
gtcgccaccggaaagatcatcgcgacccattcaaaacgccggcgccgcgtcgagtttctc
gatttcatgaacagcgtcaccgcggcttttccgaaccgcaagcttcacgtcatcctcgac
aacctcaacacccataaaaagaacgaggactggctcaaggcccaccccaacgtgcaattt
catttcacgccgacaagtgcgtcatggctcaatcaggtcgaagtatggttttcccttgca
ggggcagtcgctcagcggcacctccttcacgagcctcaagcagcttcaggaacacatcga
tgcctacgtcaacgcatacaacgacagagccgagcccttcgtctggaccaagaaaaaggt
ccgtcaacgccgtttcaaaggccgccgtatcactcagctctgattccgggtactagaagg
attgcgcggcgaggagaacatctccgagctttgtcgccgagaaggcattgccgcctcgat
ctattacggctggtccaaggagtttctcgaggccggcaagcgccgcctggccggcgacac
ggcacgagctgcgacctccggcgaggtgaaggacctccgccgggaggccggcgccttgaa
ggaggccgtcgccgatctgacgctggagaaccgtctgctcaaaaaaagtatgaacggaga
tggggaggacgaggcatgaggtatcccgcctcagagaaggccgagattcatccatttggt
cgagcaatcgcacctccggccaagcgcacgctggacaagctcgggatcccgcgcgccaca
ttctatcgctag

DBGET integrated database retrieval system