KEGG   Bradyrhizobium diazoefficiens USDA 110: blr8243Help
Entry
blr8243           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9031915..9032721
Genome map
AA seq 268 aa AA seqDB search
MGSDGGDKEGPGRSACRSSTPRPLQFVNLTVPAARRQRWHDHRGRRPIPGRAKARSPRGA
GQLTGLSEAQRRALALADNRIALSVVRRLVGYGRFDGGETARVMARLYAAARLLVNFFQP
SFKLKEKRREGPPTATSTPESRLQCLPIGNDVAEVQLVWLPSLRQLPNQLPRAVHDKDAA
ITSVLLLGHAGGLQGEVQPFCELSCMRLVVSPVGIVVIGDRPLPVAAINEQQRPMPAAVR
STGIVHWQQQEVGCIVITPIMDDAMEYA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgatggcggcgataaagagggtcccgggcggtcggcatgccggtcgtctacc
cctcggccgctccaattcgttaacttgacggtacccgctgctcgtcgacagcgatggcac
gatcatcgcgggcgaaggccgatacctggccgcgcgaaagctcggtctcctcgaggcgcc
ggtcagctgaccggtctttccgaagcgcagcgtcgcgcgctcgcccttgccgacaaccgc
atcgcgctgtcggtggtccggcggctcgtcggatacgggcgcttcgacgggggcgagacg
gcccgcgtgatggcacgtctctacgccgcggcgcgcctgctggtgaacttcttccagccg
tcattcaagctcaaagagaagcgccgcgagggtccgcccacggcgacatcaacccctgag
tcgcgcttgcagtgcctgccgattggcaacgacgttgctgaggttcagctggtctggctc
ccgtccttgcgccaattgcctaaccagctcccgcgtgccgtccacgacaaagacgccgca
atcacaagtgttctgctgctgggccatgccggcgggctgcagggcgaggttcagcctttc
tgcgagttgtcttgcatgcgtctcgttgtatctcccgtaggaatcgtagtgataggcgac
aggccgttgccggttgctgcgatcaacgaacagcagcgaccaatgcctgccgcggtccgt
agcactggcatcgttcactggcagcaacaggaagtcggctgtatcgttatcacgccgatc
atggacgatgcgatggaatacgcgtag

DBGET integrated database retrieval system