KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl2593Help
Entry
bsl2593           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1049332
NCBI-ProteinID: NP_769233
RhizoBase: bsl2593
UniProt: Q89S19
Position
complement(2837913..2838188)
Genome map
AA seq 91 aa AA seqDB search
MARKAKKRRYSRSAGSDVESEMRRYKKGTAKSGRGGRGGRVKSRKQAIAIGLSKARKKGK
KVPKKASKKTAKKKTAKRAAKKKSKRKSAKR
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaggcaaagaagcgccgttactcgcgcagcgccgggagcgatgtcgaaagc
gaaatgcggcgctacaagaagggcacggccaagagcggccgcggtggtcgcggcggacgc
gtgaagagccgcaagcaggcgatcgcaatcggcctgtcgaaggcgcgcaagaaaggcaag
aaggtcccgaaaaaggcctcgaagaaaactgccaagaagaagacggccaagagagcagcc
aagaaaaagtccaagcgcaaatccgccaagcggtag

DBGET integrated database retrieval system