KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl2596Help
Entry
bsl2596           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2611 Sugarporin_N ICAP-1_inte_bdg
Motif
Other DBs
NCBI-GeneID: 1049324
NCBI-ProteinID: NP_769236
RhizoBase: bsl2596
UniProt: Q89S16
Position
complement(2839133..2839369)
Genome map
AA seq 78 aa AA seqDB search
MKTTKLALAVMLATGLAAAPFAAQAKSHKAKHESSTSSSQTTGANTKSKGADPSGQGGSG
PGSDQGGTMTNKGTGNTK
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaccaagctcgccctcgccgtgatgttggcaaccggcctcgccgccgccccg
ttcgccgcacaggcgaagtcgcacaaggcgaaacatgagtcctcgacgtcgtcctcgcag
acgacgggcgccaacacgaaatccaagggcgccgatccttccggtcagggcggctccggt
cccggctccgatcagggcggcaccatgacgaacaagggtactggcaacaccaagtag

DBGET integrated database retrieval system