KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl2602Help
Entry
bsl2602           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1053789
NCBI-ProteinID: NP_769242
RhizoBase: bsl2602
UniProt: Q89S10
Position
complement(2849640..2849867)
Genome map
AA seq 75 aa AA seqDB search
MLSPEELAAVDDFRFKHRMPTRAAAVRELLKFGLAAAGIETSIDPSTGVKSSEFGVFGRG
PDGHAPGKSENDAED
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgctttccccggaagagctggccgcagtggatgatttccggttcaagcaccgcatgcca
acgcgtgccgcagcggtacgcgaactgctcaaattcggactcgcagccgcgggcatcgag
acgagcatcgacccgtcaacgggcgtcaaatcaagcgagtttggtgtatttggccggggg
ccagacggacacgccccgggaaaatccgagaacgacgccgaggattga

DBGET integrated database retrieval system