KEGG   Bradyrhizobium diazoefficiens USDA 110: bsl8249Help
Entry
bsl8249           CDS       T00109                                 

Gene name
cspA
Definition
(RefSeq) cold shock protein
  KO
K03704  
cold shock protein (beta-ribbon, CspA family)
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Transcription factors [BR:bja03000]
 Prokaryotic Type
  Other transcription factors
   Others
    bsl8249 (cspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(9042146..9042349)
Genome map
AA seq 67 aa AA seqDB search
MAIGTVKWFNPTKGYGFIQPDSGGNDVFVHISAVEKAGFTSLAEGAKVSFDIVKNRGKES
AENLRIE
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattgggacagtgaagtggttcaacccaacaaaggggtatgggttcattcaaccg
gattccggcggcaatgacgtctttgtccacatctccgcggttgagaaggctggttttact
tcgctcgcagagggcgcaaaagtcagcttcgacatcgtgaaaaatcgcggaaaggagtcg
gcggaaaatctacgaatcgagtga

DBGET integrated database retrieval system