KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr2770Help
Entry
bsr2770           CDS       T00109                                 

Gene name
fixS
Definition
(RefSeq) FixS protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3048740..3048907
Genome map
AA seq 55 aa AA seqDB search
MEILVILVPLALMLGGAGLVAFLWSLRSGQYDDLDGAAWRAIADDEPPQEAPVKR
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctggtcatcctggttccgctggcgttgatgctcggaggcgccggtctcgtc
gccttcctctggtcgctcaggagcggccagtacgacgatctcgacggagcggcgtggcgc
gcgatcgccgacgacgagccgccgcaggaagcgccggtcaagcgctag

DBGET integrated database retrieval system