KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8137Help
Entry
bsr8137           CDS       T00109                                 

Definition
(RefSeq) sigma-70 subunit
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r1_1
Motif
Other DBs
NCBI-GeneID: 1048893
NCBI-ProteinID: NP_774777
RhizoBase: bsr8137
UniProt: Q89BL1
Position
8932025..8932222
Genome map
AA seq 65 aa AA seqDB search
MLEGGKMERRKIIQAAIGLGRRKGFVTFEQLNQLLPAATIEPKDIEAIMQALSDEGINLI
DDDQA
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgttggagggtggaaagatggagcgacggaagataatccaagcggccattgggcttggt
cgccgcaaaggcttcgtcaccttcgagcaactcaaccagctactgcccgcagccaccatt
gagcccaaagatatcgaagcaatcatgcaggctttgagcgacgaaggaataaacctgatc
gatgacgatcaggcttga

DBGET integrated database retrieval system