KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8214Help
Entry
bsr8214           CDS       T00109                                 

Definition
(RefSeq) transposase
  KO
K07483  
transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9012099..9012509
Genome map
AA seq 136 aa AA seqDB search
MRREDFWFIVATRSEDEAEIRTGQSAAEQVLKDILRQTRRHYSSEEKIRIVLEGLRGEEN
ISELCRREGIAASMYYGWSKEFLEAGKRRLAGDTARAATSGEVKDLRRETVALKEAVADL
TLENRLLKNSMNGLYR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
ttgcggagggaggatttctggttcatcgtagccaccaggagcgaagatgaagcagaaatc
cgtaccgggcaaagtgccgcagaacaagttctaaaagacattctgcgacaaacccgccgg
cattattcgtcggaggagaagatccgcattgtgctggaaggattgcgcggcgaggaaaat
atctccgagctctgtcgccgcgagggcattgccgcctcgatgtattacggctggtccaag
gagttcctcgaggccggcaagcgccgcctggcgggcgacacggcacgagctgcgacctcc
ggcgaggtgaaggatctccgccgggagactgttgccctgaaggaggccgtagccgatctg
accctggagaaccgtctgctcaaaaatagcatgaacgggctctataggtga

DBGET integrated database retrieval system