KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8221Help
Entry
bsr8221           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve_3 rve_2
Motif
Other DBs
NCBI-GeneID: 1048254
NCBI-ProteinID: NP_774861
RhizoBase: bsr8221
UniProt: Q89BD5
Position
9016476..9016703
Genome map
AA seq 75 aa AA seqDB search
MDGKGAWRDNVFVERLWRTVKYEEVYLRAYDSVSEALASIAKYLAFYNQGRPHSSLDGRT
PDEAYFGTQAMVMAA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggacggcaagggcgcctggcgcgacaacgtgtttgtcgagcggctctggcgcacggtc
aaatacgaagaagtttatctccgcgcctacgacagcgtgtccgaggcgctagcgtcaatt
gccaagtatctggccttctacaatcagggacgccctcactcgagccttgacgggcgcacg
cccgacgaggcttacttcggcacgcaagctatggtgatggccgcatga

DBGET integrated database retrieval system