KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8221Help
Entry
bsr8221           CDS       T00109                                 

Definition
(RefSeq) transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9016476..9016703
Genome map
AA seq 75 aa AA seqDB search
MDGKGAWRDNVFVERLWRTVKYEEVYLRAYDSVSEALASIAKYLAFYNQGRPHSSLDGRT
PDEAYFGTQAMVMAA
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggacggcaagggcgcctggcgcgacaacgtgtttgtcgagcggctctggcgcacggtc
aaatacgaagaagtttatctccgcgcctacgacagcgtgtccgaggcgctagcgtcaatt
gccaagtatctggccttctacaatcagggacgccctcactcgagccttgacgggcgcacg
cccgacgaggcttacttcggcacgcaagctatggtgatggccgcatga

DBGET integrated database retrieval system