KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8241Help
Entry
bsr8241           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WGR
Motif
Other DBs
NCBI-GeneID: 1048206
NCBI-ProteinID: NP_774881
RhizoBase: bsr8241
UniProt: Q877R6
Position
9031331..9031588
Genome map
AA seq 85 aa AA seqDB search
MPNLKLGPLHLRRIDTTRNMRRFYLLSIQPTLFGGVSLIRDWGRIGTTGQTMVQTFDASA
EAGEAFGRLERAKRRRGYTSAEERV
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaccttaagctagggccgcttcaccttcgccgcatcgacaccacccgcaacatg
cggcggttttacttgctttcgatccaaccgaccttgttcggcggggtctcgctgatccgc
gactggggccggatcggcacgaccggccagacgatggtgcagactttcgatgccagcgct
gaagcgggcgaagcattcggacggctggagcgcgccaagcgcaggcgcggatacacctct
gctgaggagagagtctga

DBGET integrated database retrieval system