KEGG   Bradyrhizobium diazoefficiens USDA 110: bsr8262Help
Entry
bsr8262           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
9052670..9052954
Genome map
AA seq 94 aa AA seqDB search
MPRKLPPNVERNVVKGHAYLSFRIGKAWHLPQYGDASTPAGATRFNRKVRQQQRYAKQRA
ERLAAMTPRQRATHDAWHRARRPGLWEAIWFFLR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcaaactgccaccaaacgtcgagcgcaacgtcgtcaaggggcatgcgtatctg
tcgtttcggatcggaaaggcttggcatctgccacagtacggggacgcctcaacacctgcc
ggcgcgacgcggttcaaccgcaaggttcggcagcaacagagatatgccaaacagcgcgcc
gagcgcctggccgcgatgacgccccgacagcgagcgacgcacgacgcctggcaccgagcc
cgtcgcccgggcctatgggaggctatttggttttttctgagatga

DBGET integrated database retrieval system