KEGG   Bradyrhizobium japonicum E109: RN69_09410Help
Entry
RN69_09410        CDS       T03509                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bjp  Bradyrhizobium japonicum E109
Pathway
bjp00071  Fatty acid degradation
bjp00072  Synthesis and degradation of ketone bodies
bjp00280  Valine, leucine and isoleucine degradation
bjp00310  Lysine degradation
bjp00362  Benzoate degradation
bjp00380  Tryptophan metabolism
bjp00620  Pyruvate metabolism
bjp00630  Glyoxylate and dicarboxylate metabolism
bjp00640  Propanoate metabolism
bjp00650  Butanoate metabolism
bjp00900  Terpenoid backbone biosynthesis
bjp01100  Metabolic pathways
bjp01110  Biosynthesis of secondary metabolites
bjp01120  Microbial metabolism in diverse environments
bjp01130  Biosynthesis of antibiotics
bjp01200  Carbon metabolism
bjp01212  Fatty acid metabolism
bjp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bjp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RN69_09410
   00630 Glyoxylate and dicarboxylate metabolism
    RN69_09410
   00640 Propanoate metabolism
    RN69_09410
   00650 Butanoate metabolism
    RN69_09410
  Lipid metabolism
   00071 Fatty acid degradation
    RN69_09410
   00072 Synthesis and degradation of ketone bodies
    RN69_09410
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RN69_09410
   00310 Lysine degradation
    RN69_09410
   00380 Tryptophan metabolism
    RN69_09410
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RN69_09410
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RN69_09410
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RN69_09410
Enzymes [BR:bjp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RN69_09410
Exosome [BR:bjp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RN69_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJA60592
Position
2000931..2002103
Genome map
AA seq 390 aa AA seqDB search
MREAVIVSYARTGLAKSGRGGFNITPPMSLAAHAIKHAVSRAGVDKDYVEDCYLGNCAHG
APNIGRQAALLAGLPTTTAGVSVNRFCSSGLQTIAMAANSIRSDGADCIVAGGVESISIP
GGGSPKESIDPELLKVAPDIFMAMIDTADIVAERYKLSREYQDEFSLESQRRMAAAQQAN
KFKDEIVPMKTRMKVVDKATKAESIVDYVVDRDECNRPETTLEGLAKLEPVKGPGKFVTA
GNASQLSDGAAAVVLMEAKDAEKRGLKPLGRFVAWATAGCEPDEMGIGPVFAIPKLLKRT
GLKIDDIDLWELNEAFASQCLYSRDKLGIDPAKYNVNGGSIAIGHPFGMTGARLTGHILQ
EGARRKAKWGVVTMCIGGGQGGAGLFEIYS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagccgtcatcgtttcctatgcacgcacgggcctcgccaagtccggccgcggc
gggttcaacatcacgccgccgatgtcgctcgcggcccacgccatcaagcacgctgtgagc
cgcgccggcgtcgacaaggactatgtcgaggactgctatctcggcaattgtgcccatggc
gcgccgaacatcggccgtcaggccgcgctgctcgcgggcctgccgaccaccacggccggc
gtctccgtgaaccgcttctgctcctcgggcctgcagacgatcgcaatggccgccaactcg
atccgctccgacggcgccgactgcatcgttgccggcggcgtcgagagcatctcgatcccg
ggcggcggctcgccgaaggaatcgatcgatccggagctgctcaaggtcgcgcccgatatc
ttcatggcgatgatcgacaccgccgacatcgtcgccgagcgctacaagctcagccgcgaa
taccaggacgagttctcgctggaatcgcagcgccgcatggccgcggcccagcaggcgaac
aagttcaaggacgagatcgtcccgatgaagaccaggatgaaggtcgtcgacaaggcgacc
aaggccgagagcatcgtcgactacgtcgtcgatcgcgacgagtgcaatcgccctgaaacc
acgctggaaggattggcaaaactcgagccggtgaagggccccggcaagttcgtcaccgcc
ggcaatgccagccagctctcggacggcgccgccgccgtggtgctgatggaagccaaggat
gccgagaagcgcggcctcaagccgctcggccgcttcgtcgcctgggcgacggccggctgc
gagcctgacgagatgggcatcggccccgtgttcgcgatcccgaagctgctgaagcgcacc
ggcctgaagatcgacgacatcgatctgtgggagctcaacgaggccttcgccagccagtgc
ctctactcgcgcgacaagctcggcatcgatcccgccaagtacaacgtcaatggcggctcg
atcgcgatcggtcatcccttcggcatgaccggcgcgcgtctcaccggccacatcctgcag
gaaggtgcgcgccgcaaggccaagtggggcgtcgtgaccatgtgcatcggcggcggccag
ggcggcgccggcctgttcgagatctacagctga

DBGET integrated database retrieval system