KEGG   Bacillus sp. JS: MY9_0014Help
Entry
MY9_0014          CDS       T02027                                 

Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00230  Purine metabolism
bjs00240  Pyrimidine metabolism
bjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MY9_0014
   00240 Pyrimidine metabolism
    MY9_0014
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     MY9_0014
    2.7.1.76  2'-deoxyadenosine kinase
     MY9_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 SKI AAA_33 TsaE ABC_tran AAA_17 Cytidylate_kin2 AAA_22 RsgA_GTPase Cytidylate_kin RNA_helicase AAA_16 PRK AAA_25 AAA_14 AAA MMR_HSR1 ParA GTP_EFTU AAA_5 HTH_6
Motif
Other DBs
NCBI-ProteinID: AFI26554
UniProt: I0EZ98
Position
complement(22431..23084)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSYWEEMHTRYENWISGFNA
CPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacatcatatccctaagaattcaattattacagtagccggaacagtaggtgtc
ggaaaatcgactttaaccaaaactttagctaaacgacttggatttaaaacatctttggag
gaagtcgatcataatccatacttggaaaagttctatcatgattttgaacgttggagcttt
caccttcaaatttatttcttagctgaacgcttcaaagaacagaaaacgatttttgaagca
ggcggaggatttgtacaggatcgttcgatttatgaagacacaggaattttcgcaaaaatg
catgcagataaaggcacaatgtcaaaggtcgattataaaacttacacaagccttttcgaa
gcaatggtaatgacaccgtatttcccgcacccagatgtgttgatctatttagaaggagat
ctggagaacattttaaaccggattgagcaacgcggccgtgagatggagcttcagactagc
cgatcttattgggaagaaatgcatacacgctatgaaaactggataagcggttttaacgcc
tgccctgttttaaaacttcgcattgaagattatgatctgctgaacgacgaaaactcgatt
gaaaatattgtagatcaaattgcttccgttattcatgataatcaaaaaaagtga

DBGET integrated database retrieval system