KEGG   Bacillus sp. JS: MY9_0021Help
Entry
MY9_0021          CDS       T02027                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bjs  Bacillus sp. JS
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MY9_0021
DNA repair and recombination proteins [BR:bjs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MY9_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28802..29398
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgatagacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtggta
ttagattttgcgaaagcattagtaaatgcgaaacgcaatctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacgcgcagggataaatct
gttatctgtgttgtgcaagacccaaaggatgttatcgctatggagaaaatgaaggaatac
aatggacagtatcacgttcttcacggcgctatttctccaatggacggcatcggaccggag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatt
ctcgcgacaaaccctaatatagaaggggaagcaacggcgatgtatatatcaaggctcctc
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggtgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system