KEGG   Bacillus sp. JS: MY9_0045Help
Entry
MY9_0045          CDS       T02027                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00900  Terpenoid backbone biosynthesis
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01130  Biosynthesis of antibiotics
Module
bjs_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MY9_0045
Enzymes [BR:bjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MY9_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFI26585
UniProt: I0EZC9
Position
53560..54438
Genome map
AA seq 292 aa AA seqDB search
MKAMRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTELAEDEVRVSSHN
RFVPDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLW
NLNLSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPHCWVILAKPTIGVST
AEVYRALKLDDIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTLDLHPEVAMIKNQMKR
FGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctatgcgtattttagaaaaagcgccagccaagatcaatctgtcacttgacgtc
acccgaaaacgcccggatggttatcatgaagtcgaaatgatcatgacgacaattgattta
gctgatcgaattgaattgacggagctggcagaggatgaagtgagggtttcctcccacaac
cgttttgtgcctgatgaccaaagaaacttagcttatcaggccgccaagctgatcaaggac
agatacaacgtgaaaaagggagtttccatcatgattacgaaggtaattccggtggctgcc
ggtcttgccggcggaagcagtgatgcggcggcgacgctcagagggctgaacagactgtgg
aatttaaatctttctgcggaaacgcttgctgagcttggagcggaaattggctccgacgtt
tcattttgtgtctatggaggaactgcacttgcaacagggcgcggcgagaaaattaaacat
atcagcacgcctccgcactgctgggtcattttagcgaagccgacaatcggtgtttcaact
gctgaagtgtacagagcgctgaaactggatgacatagagcatcccgatgtacaaggcatg
atcgaggcgatagaggaaaagagttttcagaagatgtgcagccgtttaggcaatgtgctc
gaatctgttacgcttgatctgcatcctgaagtcgcgatgatcaaaaaccagatgaaacgc
tttggtgcagatgccgtgttaatgagcgggagcggtccgacagtgtttggactggttcag
tatgagtcgaaggtgcagagaatttataacgggttaagaggcttctgcgatcaagtttat
gcggtgagaatgatcggcgaacagaacgctcttgattaa

DBGET integrated database retrieval system