KEGG   Bacillus sp. JS: MY9_0076Help
Entry
MY9_0076          CDS       T02027                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bjs  Bacillus sp. JS
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bjs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86999..87502
Genome map
AA seq 167 aa AA seqDB search
MNNIAYIALGSNIGNRETYLRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQDEFLNMAV
EIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMY
ERLFVLAPLAEICQQVEKEATSAETNQEGVRVWKQKSGVDEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatagcttatattgcacttggatctaacattggaaatagagaaacgtattta
aggcaagcagtggccctgctgcatcagcatgctgcagtgacagtcactaaagtgtcgtca
atttacgaaactgacccggtcggatacgaagaccaagatgagtttttgaatatggctgtt
gaaatcaaaacatcactaaacccttttgaactccttgaactgacgcagcagatagaaaac
gaattaggcagaacaagggaagtaagatgggggccgcggacggcagaccttgacattttg
ttatttaatcgtgaaaatattgaaacagagcaactaattgttccgcatccgagaatgtat
gagcgtttgtttgtccttgcgccgcttgcggaaatttgccagcaggttgaaaaagaggct
acaagcgctgaaacaaaccaagaaggtgtaagagtatggaagcagaaatctggggtagac
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system