KEGG   Bacillus sp. JS: MY9_0091Help
Entry
MY9_0091          CDS       T02027                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bjs  Bacillus sp. JS
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MY9_0091
Enzymes [BR:bjs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     MY9_0091
Amino acid related enzymes [BR:bjs01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MY9_0091
Transfer RNA biogenesis [BR:bjs03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MY9_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111103..112554
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE
EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKVIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWSPVGEEELFTKEQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFADEIEYNQEAKAVLEEEQVPEVLSTFAAKLEE
LEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRL
KNI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaagtacgcgtccgttatgcaccgagtccaaccggacatttgcatattgga
aatgccagaacggcgctttttaattatttatttgctcgcaatcaaggcggtaagtttatc
attcgtgttgaggacactgataaaaagcgcaatattgagggcggagaacaaagccagctg
aattatctgaagtggctaggtattgactgggatgagagtgtggatgtcggcggagagtac
ggcccataccgtcagtcagagcgtaacgatatctataaagtgtactatgaagagctcctt
gaaaaagggcttgcttataaatgctactgtacggaagaagagcttgaaaaagagcgtgaa
gagcagattgcccgcggagaaatgccacggtattctgggaaacacagagatctgactcag
gaagaacaggagaaatttattgctgaaggcagaaagccgagtattcgtttccgtgttcca
gaaggaaaagtcatcgccttcaacgacatcgtaaaaggcgaaatttcttttgaatcagat
ggcattggcgacttcgttattgtgaaaaaggacggaacgcctacttataacttcgcggta
gctattgatgactacttaatgaaaatgacacacgtgctgcgcggtgaggatcatatttct
aacacaccgaaacagattatgatctatcaagcattcgggtgggatattccacagttcgga
catatgacgctgattgtaaacgaaagccgtaaaaagctcagcaaacgtgatgaatccatt
attcaattcatcgagcagtacaaagagcttggctacttgccagaagcgctgttcaacttt
atcgggctgctaggctggtcaccggttggagaagaagagcttttcacaaaagagcagttt
attgaaatttttgatgtaaatcgtttatctaaatcaccagctttgtttgatatgcataag
ctaaaatgggttaacaaccaatatgtgaagaagctggatcttgatcaggttgttgaactg
acgcttccgcatttgcaaaaagccggcaaagttggcactgagctttctgctgaagaacaa
gagtgggttcgcaaattgatttccctgtatcatgagcaattaagctacggtgccgaaatt
gttgagctgactgatttgttctttgcggatgagatcgagtataatcaagaagcgaaagct
gttctggaagaggagcaggttcctgaagtgctcagcacattcgctgcgaagcttgaagag
cttgaggagttcactccagataatatcaaagcatcgatcaaagcagtgcagaaagaaact
ggccacaaagggaaaaaactgtttatgccgattcgtgttgctgttacagggcaaactcac
ggtccggaactgccgcaatcaatcgaattgatcggtaaagagactgcgattcagcgtttg
aaaaatatctaa

DBGET integrated database retrieval system