KEGG   Bacillus sp. JS: MY9_0171Help
Entry
MY9_0171          CDS       T02027                                 

Definition
putative beta-hexosaminidase lipoprotein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bjs  Bacillus sp. JS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bjs00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bjs00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(190754..192682)
Genome map
AA seq 642 aa AA seqDB search
MKPVFPLILSAVLFLSCFLVANQKEATASKSSIDANQIVNRMSLDEKLGQMLMPDFRNWQ
KKGESSPQALTEMNEEVASLVKKYQFGGVILFAENVKTTKQTVQLTDAYQKASPKIPLIL
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKELSALGINTDFSPVVDIN
NNPDNPVIGVRSFSSNRKLTSRLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHDQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILLPATLSKKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPASVTSLKEEQK
FSRVIQALKEAVKNGDIPEHQINKSVERIISLKIKRGMYPARNDDSTKEKIAKAQKIVGS
KQHLKAEKKIAEKAVTVLKNEQHTLPFKPKKGSRILIVAPYEEQTASIEQTIRDLVNRKK
IKPVSVDKMNFANQVFKAEHEKQVKKADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYTNGRYLQPNIPAGV
MAIFGQTKPKGTLPVDIPSVTKPGNTLYPFGYGLNIKTGKPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtctttccgcttatcctttcagccgttctttttctttcatgttttctcgtg
gctaaccagaaagaagccactgcatctaaaagttcaatcgatgccaatcagattgtcaat
cgtatgtcattagatgaaaaactcggtcagatgctgatgcctgattttagaaattggcaa
aagaaaggcgagtcctcaccgcaagcccttacggaaatgaatgaggaagtcgccagcctc
gtcaagaaatatcaattcggaggcgtcattctttttgcagaaaatgtaaaaacaacaaag
caaacggtccagctgacagacgcttaccaaaaggcaagtcccaaaatcccactcatactt
agtattgatcaggaaggcggcattgtaacgaggctaggggagggcactaatttcccaggg
aatatggcgctgggcgcagccagaagcagaatcaatgcgtatcagaccggcagcatcatt
ggaaaagagctctcggccttaggcatcaatacagatttcagccctgtcgtagacattaac
aataatcctgataatcctgtaatcggcgtacggtcattcagctccaatcgaaaactgaca
tcacgactcggtttatacacgatgaaagggttgcagcggcaggatatcgcctctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattatggactgccgctcgtt
tcccatgatcaagaacggcttcgagaggtcgagctctatccttttcaaaaagcaattgat
gccggtgctgatatggtgatgacagcccatgttcaattccctgcctttgacgacaccaca
tacaaaagcaaactcgatggatcggacattttgcttccagctacactttcgaaaaaagtg
atgacaggccttcttcgtcaggaaatgggctttaatggggtcatcgttaccgatgcgctc
aatatgaaggcaatcgcagatcatttcggacaggaagaggctgtggtcatggccgtaaaa
gctggtgtcgatattgcattaatgccagcctcagttacttcattgaaagaagaacagaaa
ttctcacgtgttattcaagctttgaaagaagccgtgaaaaacggagacattcctgaacat
caaatcaacaaatcagttgaaagaatcatttccctgaaaataaaacgcggcatgtatcca
gcacggaacgacgacagtacaaaagaaaaaatagccaaagcccaaaaaatcgtaggaagc
aagcagcacctgaaagcagagaaaaaaatagctgaaaaagcagtaactgtattaaaaaat
gaacagcacactttgccgttcaagcccaaaaaaggcagccgaatcttaattgtggcacct
tacgaagaacaaactgcttcaatcgaacaaaccattcgcgatctcgtcaatcgtaagaaa
atcaaacccgtatctgtcgacaaaatgaattttgccaaccaagtatttaaggccgagcat
gaaaaacaagtaaaaaaggctgattatatcattaccggttcctatgtcgtcaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacaccatatctgattcaagcaaatgggctacc
gtgtttccgagagctgtcatgaaagccgcactgcagcacaataaaccttttgtcttaatg
agtctgcgcaatccctatgatgccgccaattttgaagaagcaaaggcactgattgctgtc
tatggctttaaaggatacacaaatggccgttatcttcaacctaatattccggccggagtg
atggcgatattcggccagacaaaacctaaaggcacacttccagttgacattccgtcagtc
acgaaaccagggaacaccctttacccatttggctacggtttaaatatcaaaacgggaaaa
ccgctttaa

DBGET integrated database retrieval system