KEGG   Bacillus sp. JS: MY9_0267Help
Entry
MY9_0267          CDS       T02027                                 

Definition
PhoD protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bjs  Bacillus sp. JS
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MY9_0267
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MY9_0267
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MY9_0267
Enzymes [BR:bjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MY9_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278559..280310
Genome map
AA seq 583 aa AA seqDB search
MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTIAQSVGAFEVNAAPKF
SSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKWEVAKDEHFRKIVRKGT
EMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTLPAPGANVPQMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHNSAEIYTLQDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDDQANNDGNKPPSDESRNPNRT
LLGKEQEQWLFNNLSSSTAHWNVLAQQIFFAKWNFGTSASPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFGAEFVGTSITSGGNGSDKRADTD
QILKENPHIKFFNDYRGYVRCTVTPHQWKADYRVMPFVTEPGAAISTRASFVYQKDQTGL
RKVSSTTIQGGVKQSDEVEEDRFFAHNKAHEKQMIKKRAKITN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgacagtcgttttgatgaatgggtacagaaactgaaagaggaaagctttcaa
aacaatacgtttgaccgccgcaaatttattcaaggagcggggaagattgcaggactttct
cttggattaacgattgcccagtcggttggagcctttgaagtaaatgctgcgcctaaattc
tcaagctatccgtttacattaggggtagcgtcaggtgatccgctttctgacagtgtcgtg
ctctggacgcgcctggcaccagatccgctgaatggcgggggaatgccgaagcaagcggtg
cctgtcaaatgggaggttgcaaaggatgagcattttcgcaaaatcgtaagaaaaggcact
gaaatggctaaaccgagtcttgcccattccgttcatgtggaagcggacgggcttgagccg
aacaaagtgtactattaccgtttcaaaaccggacatgaactaagccctgtcggaaaaaca
aaaacactgcctgcccctggcgccaatgtgccgcaaatgacctttgcgtttgcttcctgc
cagcaatatgagcatggatattatacggcctacaagcatatggcgaaggaaaagcttgat
cttgtcttccatctcggtgattacatatatgaatacgggccaaatgagtatgtatcaaaa
acgggcaatgtccgcacgcacaacagcgcggaaatctatacgctgcaagactatcgaaac
cgtcacgcccaataccgctctgatgccaatcttaaagcagcacatgctgcgttcccttgg
gttgtgacatgggatgaccatgaagtcgaaaacaactatgccaataaaataccggaaaaa
ggacagtcggttgaagcattcgtgctccgccgcgcggcagcatatcaggcatactatgaa
catatgccgctccgcatttcatctttgccgaatggcccggatatgcagctgtaccggcac
tttacgtacggaaacctggcgtccttcaatgtgcttgatacccgccagtacagggatgac
caagccaataacgacggcaataagccgccttctgatgaatcacgaaatccgaatcgaacc
ctgcttggaaaagaacaggagcagtggcttttcaacaatttgagcagctcgaccgcccac
tggaatgtgttggcgcagcaaattttctttgcgaaatggaattttgggacaagcgcaagc
ccgatctacagcatggattcttgggacggctatccggctcagcgcgaacgggttatcaat
ttcattaaaagcaaaaatctgaataatgttgtcgtactgacgggtgatgtacacgcaagc
tgggcatcgaatttgcatgtcgatttcgagaagacaagttcaaaaatatttggagccgaa
tttgtcggaacctcgatcacatccggaggaaacggctcagataagcgggcggatacagac
caaattctaaaagaaaatccgcacatcaagttctttaacgactatcgcggatatgtccga
tgtacagtgacgcctcaccagtggaaagccgactatcgggtgatgccgtttgtgaccgag
ccgggcgcagccatttccacgcgggcttcattcgtttaccagaaagatcaaaccgggctg
agaaaggtatcatctacaacaatccaaggcggggtgaagcaatccgatgaggtcgaagag
gatcgtttctttgcgcacaacaaagcccacgagaaacaaatgattaagaagcgtgcaaaa
atcacgaattaa

DBGET integrated database retrieval system