KEGG   Bacillus sp. JS: MY9_0805Help
Entry
MY9_0805          CDS       T02027                                 

Definition
glycosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bjs  Bacillus sp. JS
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bjs00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bjs00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bjs00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
849135..850466
Genome map
AA seq 443 aa AA seqDB search
MSTLHQIKIAYIGGGSQGWARSLMSDLAIDERMSGMVALYDLDFEAAQRNEVIGNYSGNG
RWRYEAVSTLKKALSGADIVIISILPGSLDDMEIDVHLPERCGIYQSVGDTVGPGGIIRG
LRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRALYKVFPGIKAIGCCHEVFGTQKLL
AEMVTERLGIEVPRREDIHVNVLGINHFTWITAASYRHIDLLPIFREFSSHYGESGYELE
GESWRDSVFHSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPISFRK
QDRALKRQETERFIQQQRGVAGKASGEEGVNIIAALLGLGELVTNVNMPNQGQVSNLPIQ
AIVETNAFITRNSVKPIFSGALPKGVEMLAARHVSNQEAVAEAGLTKDTGLAFQAFLNDP
LVMIDRNDAEQLFDDMHQSTIQS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgttacatcagattaaaattgcctatatcggcggggggtctcaaggctgggcc
agaagcctgatgagtgatttggcgattgatgagaggatgtcaggcatggtggcactctat
gatcttgattttgaggccgcccagagaaacgaagtgatcggcaattacagcgggaacggc
agatggagatatgaggccgtttctactttgaaaaaggcgctatctggcgcggatatcgtc
attatttccattttgccgggttctctggatgatatggaaattgatgttcacttgcctgag
cgctgcggtatttatcagtctgtaggtgatactgtcgggccgggcggaatcatcagaggc
ttgcgagctgtcccgatatttgcggaaattgcccgggcaataagagactacgcaccagag
tcctgggttattaattatacaaatccaatgtctgtctgtactagagcgttgtataaagtg
tttcccggaatcaaagcgataggctgctgccacgaggtgttcgggacgcaaaagctattg
gcggaaatggtcacggaaaggctgggaatagaggtgccgcggagagaagatatccatgtt
aatgtgctcggcattaaccattttacatggattacggcagcctcttaccgccatattgac
ctgctgcctatattccgtgaattcagctcgcactatggggaatcaggatatgagctggag
ggagaaagctggagggacagcgtctttcattcggcacaccgtgttgcgtttgatttattt
gaaacgtatggcgcgatccctgctgcgggtgacaggcacctggcagagtttcttcccggt
ccatatcttaaacagcctgaggtatggaaattccatctcacacctatatcattcagaaaa
caagacagagcactgaaacgacaagaaacagaacggttcattcagcaacaacggggtgtt
gctgggaaagcttcgggagaagaaggcgtgaacatcatagcggcccttctcggattgggt
gaactcgtcacgaatgtaaatatgccgaatcaaggccaggtctcaaaccttcctatacaa
gccattgtcgaaacaaacgcattcatcacaaggaacagtgtcaagccgattttttccgga
gcgcttccaaaaggtgtggaaatgctggcggctaggcatgtatccaatcaggaggcagtg
gcggaagctggtttgacaaaggatacaggcctcgcgtttcaagccttccttaatgacccg
cttgtcatgattgaccgcaatgatgcagagcagctttttgatgacatgcatcaaagcacc
atacaaagctga

DBGET integrated database retrieval system