KEGG   Bacillus sp. JS: MY9_0899Help
Entry
MY9_0899          CDS       T02027                                 

Definition
(GenBank) acetoin cleaving system dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00010  Glycolysis / Gluconeogenesis
bjs00020  Citrate cycle (TCA cycle)
bjs00620  Pyruvate metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
bjs01130  Biosynthesis of antibiotics
bjs01200  Carbon metabolism
Module
bjs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_0899
   00020 Citrate cycle (TCA cycle)
    MY9_0899
   00620 Pyruvate metabolism
    MY9_0899
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MY9_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 HlyD_D23 Biotin_lipoyl_2 PYNP_C GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFI27438
UniProt: I0F1T2
Position
936927..938123
Genome map
AA seq 398 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSIWNKKVGDPVEKGESIASIQSEKIEMEIEAPEKGTLIDIK
VKEGEEVPPGTAICYIGDANESVQEEASRPAAEDSVPQAVQPVKQENKPAASKKDRLKIS
PVARKIAEKAGLDLKQLKGTGPGGRIVKDDVTKALAEQKKAQAKPVSDQKAQETPVTGMR
KVIAARMQESLANSAQLTITMKADITKLATLQKQLSPAAEERYGTKLTITHFVSRAAVLA
LQAHPVLNSFYQNERIITHPHVHLGMAVALENGLVVPVIRHAEKQSLIELAQSISENAKK
AREGRAGSDELQGSTFSITNLGAFGVEHFTPILNPPEAGILGIGASYDTPVYQGEEIVRS
TILPLSLTFDHRACDGAPAAAFLKAIKTYLEEPAALIL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaaagtagtgatgccaaaattaggaatggcgatgaaacaaggggaagtatcg
atatggaataaaaaagtaggcgacccggttgaaaagggagaaagcattgccagcattcaa
tcggagaaaattgaaatggagatcgaagcgcctgaaaaaggaacgctgatcgacatcaaa
gtgaaagagggagaagaggttccgcccggcactgcaatctgctacatcggagacgccaat
gagtcggtgcaggaagaggcaagcaggcctgctgctgaagacagcgtgccgcaagccgtc
cagcccgtcaaacaagaaaacaaacccgcagcctccaaaaaagatcgattgaaaatatct
ccagttgcgagaaaaatagcggaaaaagcggggttagacctgaaacagctgaaaggcacc
ggaccaggcggaagaatcgtgaaggatgacgtgacaaaggcgctggctgaacagaaaaaa
gctcaggcaaaacctgtttctgatcagaaagcgcaggaaaccccggtgacaggcatgaga
aaagtcatcgctgcccgaatgcaggaaagcttggcaaacagcgcgcagctgacgattacg
atgaaggctgatatcactaagcttgctactcttcaaaaacagctttcaccagctgcggaa
gaacggtacggcacaaaactgacaatcactcattttgtctcaagagccgccgttctcgca
ctgcaagctcacccagtgctgaacagcttttatcaaaatgagcgcatcatcacacatcct
catgtgcaccttggtatggctgtagccttggaaaatggcttagtggtgcctgtcatccgt
catgctgaaaagcaatcgctgattgaactggctcaatccatctcagaaaatgccaaaaaa
gcacgtgagggacgtgcgggaagcgacgagctgcaaggctcaaccttctccattacaaac
cttggcgcttttggagttgagcatttcacaccgatattaaatccgcctgaagcaggcatt
ctcggcatcggagcaagctatgacacaccggtgtaccaaggggaggagatcgtcagaagc
acgatcctgccgctcagcctgacatttgatcacagagcgtgtgacggcgccccagccgct
gcattcctgaaggcgataaaaacatatttggaagaacccgcagcattaattttatag

DBGET integrated database retrieval system