KEGG   Bacillus sp. JS: MY9_1025Help
Entry
MY9_1025          CDS       T02027                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bjs  Bacillus sp. JS
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bjs00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057655..1059145
Genome map
AA seq 496 aa AA seqDB search
METYILSLDQGTTSSRAILFNKEGKIVHSAQKEFTQYFPNPGWVEHNANEIWGSVLAVIA
SVISESGISASQIAGIGITNQRETTVVWDKDTGSPVYNAIVWQSRQTSGICEQLREKGYN
DKFREKTGLLIDPYFSGTKVKWILDNVEGAREKAEKGELLFGTIDTWLIWKMSGGKAHVT
DYSNASRTLMFNIYDLKWDDELLDILGIPKSMLPEVKPSSHVYAETVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAIKSEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLKTLRVDGGAVKNNFLMQF
QGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIANQWNLDKRFEPELEEEKRNE
LYKGWQKAVKAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgtacattttatccttagatcaggggacaacaagttcaagagcgattctgttt
aataaagaaggcaaaatcgttcactccgctcaaaaggaatttacacaatacttcccgaat
cctggctgggttgagcataatgccaatgaaatttggggctctgtgctcgcggttatcgcg
tcagtcatctctgaatcaggaatcagcgcttctcaaattgcgggcatcggcatcacgaac
cagcgcgagacgacggttgtgtgggataaagatacaggcagtcctgtctataatgcaatt
gtttggcagtccagacagacgtccggcatttgtgagcaacttcgtgaaaaaggatataat
gataaattcagagaaaaaactgggcttttaatcgatccatacttctccggcacgaaggtg
aagtggattttagataatgtggaaggcgcaagagaaaaagcggaaaaaggcgagctgctg
ttcggaacgattgatacatggctcatttggaaaatgtcaggcggaaaagcgcatgtgacc
gattactccaatgcctccagaacgctgatgtttaatatttacgatttaaaatgggacgat
gaactgctcgacattttaggcataccgaaatccatgctccctgaagtgaagccgtcttcc
catgtgtatgcggagactgttgattatcatttcttcggaaaaaatatcccgattgcggga
gcggcaggcgaccagcagtccgcattgttcggccaagcgtgctttgaagaaggcatggga
aaaaacacatacggcactggatgtttcatgctgatgaataccggggaaaaagcaattaag
tccgaacacgggcttttgacgacaatcgcttggggcattgacggaaaagtgaactatgcg
ttagaaggaagcatttttgtcgcaggctctgccatccagtggcttagagacggattgaga
atgttccaggattcatcgctaagcgaatcttatgcagaaaaagtagattcaactgacggc
gtgtatgtcgttccggcatttgtcggactgggaacgccttactgggacagcgatgtgcgc
ggttcggttttcggcctgacaagagggacaacaaaagagcactttatccgtgcgacactg
gagtcattggcttatcagacaaaagatgtgcttgacgcaatggaagcagattcaaacatt
tcattaaagacgcttcgtgtagacggaggagctgtgaaaaacaatttcctgatgcagttc
cagggagatctgctgaatgttcctgtggagcgtccggaaattaatgaaacgactgcactt
ggcgcggcttatttggcaggtatcgctgtgggattctggaaggaccgttctgaaatcgcg
aaccagtggaatctggataaacggtttgaacctgaattagaagaagaaaaacgaaatgag
ctgtataaaggctggcaaaaagccgtgaaagcagctatggcttttaaataa

DBGET integrated database retrieval system