KEGG   Bacillus sp. JS: MY9_1131Help
Entry
MY9_1131          CDS       T02027                                 

Definition
subtilisin
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bjs  Bacillus sp. JS
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1158776..1159921)
Genome map
AA seq 381 aa AA seqDB search
MRNKKLWISLLFALTLIFTMAFSNMSAQAAGKSSTEKKYIVGFKQTMSAMSSAKKKDVIS
EKGGKVQKQFKYVNAATATLDEKAVKELKQDPSVAYVEEDHIAHEYAQSVPYGISQIKAP
ALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAGTIAA
LNNSIGVLGVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPSGSTA
LKTVVDKAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGS
ELDVMAPGVSIQSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTA
TYLGSSFYYGKGLINVEAAAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaacaaaaaattgtggatcagcttgttgtttgcgttaacgttaatctttacgatg
gcgttcagcaacatgtctgcgcaggctgccggaaaaagcagtacagaaaagaaatacatt
gtcggatttaaacagacaatgagtgccatgagctccgccaagaaaaaggatgttatttct
gagaaaggcggaaaagttcaaaagcagtttaagtatgttaacgcagccacagcaacattg
gatgaaaaagctgtaaaagaattaaaacaagatccgagtgttgcatatgtggaagaagat
catattgcacatgaatatgcgcaatctgttccttacggcatttcccaaattaaagcgccg
gctcttcactctcaaggctacacaggctctaacgtaaaagtagctgttatcgacagcgga
attgactcttctcatcctgacttaaacgtcagaggcggagcaagcttcgtaccttctgaa
acaaacccataccaggacggcagttctcacggtacgcacgtagccggtacgattgccgct
cttaataactcaatcggtgttctcggcgtagcgccaagcgcatcattatatgcggtaaaa
gttcttgattcaacaggaagcggccaatacagctggatcatcaacggcattgaatgggcc
atttccaacaatatggatgttatcaacatgagccttggcggaccttctggttctacagcg
ctgaaaacagttgttgataaagccgtttccagcggtattgtggttgcggccgcagccgga
aacgaaggctcgtccggaagctcaagcacagtcggctatcctgcgaaatatccttctacc
atcgcggtaggtgcggtaaacagcagcaaccaaagagcttcattctcaagcgcaggttct
gagcttgatgtgatggctcctggcgtatctatccaaagcacacttcctggaggcacttac
ggtgcttacaacggaacgtcaatggcgactcctcacgttgccggagcagcagcgttaatt
ctttctaagcacccgacttggacaaacgcgcaagttcgcgatcgtttagaaagcactgca
acataccttggaagctctttctactatggaaaagggttaatcaatgtagaagcagctgcc
caataa

DBGET integrated database retrieval system