KEGG   Bacillus sp. JS: MY9_1336Help
Entry
MY9_1336          CDS       T02027                                 

Definition
(GenBank) YjjA
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bjs  Bacillus sp. JS
Pathway
bjs00860  Porphyrin and chlorophyll metabolism
bjs01100  Metabolic pathways
bjs01110  Biosynthesis of secondary metabolites
bjs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MY9_1336
Enzymes [BR:bjs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MY9_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFI27873
UniProt: I0F317
Position
1341846..1342658
Genome map
AA seq 270 aa AA seqDB search
MGKGLHGKRVAIGGSRKTEEISTIIEKQGGTPVIRPLQGTVYLAEKQVEPDLRTFVEEKA
DWVIFTTGIGTETLFDMAEKIGLKDEFLQAIRQAKAACRGYKTLSVLKKLGITPEASDED
GTTRGLIRSLEPHDFSGKKVMVQLHGENAPALIAFLKEKGASVLPILPYQHIPPEEETVE
RLCGELMNNDIDAVCFTTAIQVRSLFDFARERGYINEVKTVFEERTIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIIELAKYYEEKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacatggaaagcgcgtggcaatcgggggctcccgaaaaacggaagaa
atcagtacaatcattgaaaaacagggcggaacacctgtcatcaggcctctccaaggcacg
gtttacttagcggagaagcaggtggaaccggacttgcgaacgtttgtcgaggaaaaagct
gactgggtcattttcacgacaggcatcggcacggaaactctgttcgatatggcagagaaa
atcggtctgaaagacgagtttctgcaggcgattcgccaggcaaaagcggcatgtcgggga
tacaaaaccctgtctgtgctgaaaaagcttgggatcacaccggaagcttcggatgaagat
gggacaacaagaggcttaatccgttccttggagccccacgacttttcagggaaaaaagtc
atggtgcagcttcatggagaaaatgcgccggcccttatcgcatttcttaaagaaaagggc
gcgtctgtcctgccgattcttccttatcagcacattccgccggaggaggaaacggtggag
cggttatgcggggagctgatgaataatgatatcgacgctgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccagggagcgaggctatatcaatgaagtgaagaca
gtattcgaagagcgcaccatcgcagctgctgtcggaaaagtgactgctgaggcgctgcgg
gaagaaggcatcacgagactgcttgcgccagagattgagcggatgggcgcgatgattatt
gagctggccaaatattatgaagaaaaggaataa

DBGET integrated database retrieval system