KEGG   Bacillus sp. JS: MY9_1336Help
Entry
MY9_1336          CDS       T02027                                 

Definition
protein YjjA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bjs  Bacillus sp. JS
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bjs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341846..1342658
Genome map
AA seq 270 aa AA seqDB search
MGKGLHGKRVAIGGSRKTEEISTIIEKQGGTPVIRPLQGTVYLAEKQVEPDLRTFVEEKA
DWVIFTTGIGTETLFDMAEKIGLKDEFLQAIRQAKAACRGYKTLSVLKKLGITPEASDED
GTTRGLIRSLEPHDFSGKKVMVQLHGENAPALIAFLKEKGASVLPILPYQHIPPEEETVE
RLCGELMNNDIDAVCFTTAIQVRSLFDFARERGYINEVKTVFEERTIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIIELAKYYEEKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacatggaaagcgcgtggcaatcgggggctcccgaaaaacggaagaa
atcagtacaatcattgaaaaacagggcggaacacctgtcatcaggcctctccaaggcacg
gtttacttagcggagaagcaggtggaaccggacttgcgaacgtttgtcgaggaaaaagct
gactgggtcattttcacgacaggcatcggcacggaaactctgttcgatatggcagagaaa
atcggtctgaaagacgagtttctgcaggcgattcgccaggcaaaagcggcatgtcgggga
tacaaaaccctgtctgtgctgaaaaagcttgggatcacaccggaagcttcggatgaagat
gggacaacaagaggcttaatccgttccttggagccccacgacttttcagggaaaaaagtc
atggtgcagcttcatggagaaaatgcgccggcccttatcgcatttcttaaagaaaagggc
gcgtctgtcctgccgattcttccttatcagcacattccgccggaggaggaaacggtggag
cggttatgcggggagctgatgaataatgatatcgacgctgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccagggagcgaggctatatcaatgaagtgaagaca
gtattcgaagagcgcaccatcgcagctgctgtcggaaaagtgactgctgaggcgctgcgg
gaagaaggcatcacgagactgcttgcgccagagattgagcggatgggcgcgatgattatt
gagctggccaaatattatgaagaaaaggaataa

DBGET integrated database retrieval system