KEGG   Bacillus sp. JS: MY9_1491Help
Entry
MY9_1491          CDS       T02027                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bjs  Bacillus sp. JS
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bjs00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479131..1479667
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEANTMIEHQEEVASFLDSQEVIYEQWDIAKLPEHLSEKYDLTEEEKQQILDT
FETEIKDISTRRGYKAQDVISLSDSNPKLDELLENFKREHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKNSVSQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattcgaattcatgatgaggcaaatacaatgattgaacatcaagaggaagta
gcaagctttctggacagtcaagaggttatttatgagcaatgggatatcgcgaagcttccg
gaacatctctcagagaaatatgatttgacagaagaagaaaaacagcaaattcttgatacc
tttgaaactgaaattaaagacatctcaacccgccgtggctacaaagcacaggatgttatt
tcattgtcagacagcaacccgaaacttgatgaactgcttgaaaattttaaaagagagcat
caccatacagacgatgaggttcgttttatcgtaagcggacacggtatttttgtcattcaa
ggcaaggacggcacgttttttgatgtccgtttgaaccctggagatttaatctccgtgcct
gagaatatccgccattacttcacgcttcaggaggaccgcaaagttgtcgcggtgagaatt
tttgtcacaactgaaggctgggttccgatttatgaaaaaaacagcgtgagtcaataa

DBGET integrated database retrieval system