KEGG   Bacillus sp. JS: MY9_1599Help
Entry
MY9_1599          CDS       T02027                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bjs  Bacillus sp. JS
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bjs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MY9_1599
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY9_1599
   00020 Citrate cycle (TCA cycle)
    MY9_1599
   00620 Pyruvate metabolism
    MY9_1599
Enzymes [BR:bjs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MY9_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577003..1578331
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSDESDEAKTEAQVQSTAEAGQDVAKEEQAKEP
AKATGAGQQDQAEVDPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAQEAAPQETAAPQETAAKPAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKSVFEISDEINGLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagcctaacgacgaggtagacgaagatgatgtactggctgaagtccaa
aatgataaagcagtagtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgattattacgtttgatgcacctggt
tacgaagatcttcaatttaaaggcagcgatgagtctgacgaagcgaaaactgaagcacaa
gttcagtcaactgcagaagctggacaagacgttgcgaaagaagagcaagctaaagagcct
gcaaaagctactggtgcaggacagcaagaccaagctgaagttgacccgaacaaacgcgtg
atcgctatgccttctgtacgcaaatatgctcgtgaaaaaggcgtagacatacgtaaagta
actggttctggcaacaacggacgtgttgtcaaagaggatatcgacagctttgtaaacgga
ggagcgcaagaagctgcgccgcaagaaacggctgcaccacaagaaacagctgctaaaccg
gctgctgcaccagctcctgagggcgaattcccagaaacacgcgaaaaaatgagcggtatc
cgtaaagcaattgcgaaagcgatggttaactctaaacacactgctcctcacgtaacgtta
atggacgaagtggacgtaacaaacctcgttgcacatcgtaaacagttcaaacaagttgct
gctgatcaaggaatcaagctgacttacttgccttacgttgtaaaagctcttacatctgca
ctgaaaaaattccctgttttaaacacgtcaattgacgataaaacagatgaagttatccaa
aaacattacttcaacatcggtatcgctgctgacactgaaaaaggcttgcttgtaccggtt
gtgaaaaatgcagatcgtaaatctgtctttgaaatttctgatgaaatcaatggccttgca
acaaaagctcgtgaaggcaagcttgctccagctgaaatgaaaggcgcatcttgcacaatt
acaaacatcggttctgccggcggacaatggttcactccggttatcaaccatccagaagtt
gcgattcttggtatcggacgcattgcagaaaaagcgattgttcgtgatggcgaaatcgta
gcagctccagtcttagctctttctctcagcttcgaccaccgtatgatcgacggagcaact
gcgcaaaatgcattaaatcacatcaagcgtttactgaacgatccacaattaattttaatg
gaggcgtaa

DBGET integrated database retrieval system