KEGG   Bacillus sp. JS: MY9_1623Help
Entry
MY9_1623          CDS       T02027                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bjs  Bacillus sp. JS
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bjs00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bjs00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bjs00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1597801..1598730
Genome map
AA seq 309 aa AA seqDB search
MVCRHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKT
FTLQSISKVLALALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGA
LVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYG
IFEDDVEAVMDLYTKQCAIEMSSLDLAKIGSVFALNGRNPETGEQVISKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIM
SEMYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccggcataatgatgagcttgaagccttagtgaaaaaggcgaaaaaagtaacg
gataagggggaggtagccagttatattcctgccttggcaaaagctgataaacacgatctg
tcagtggcgatttattattccaataatgtttgcctgtcagcaggtgacgtagaaaaaaca
tttacgcttcaaagtatatcgaaagtccttgcacttgctttggtgttaatggaatacggc
aaagataaggtcttcagttatgttggacaggagccgaccggtgatccgtttaattcaatt
atcaagctggaaacagtaaatccaagcaagccgttaaaccctatgattaatgccggggca
ttggtagtgacaagtctgattagaggaagaacggtgaaagagagacttgattatttgctt
tcttttattagaaggctgacaaacaaccaagagattacatactgccgggaagtggctgaa
tccgaatacagcacttcaatgattaatcgggcaatgtgttattatatgaagcagtacggc
atttttgaggatgatgtagaagcagtaatggatttatacacgaagcaatgcgcgattgag
atgagcagcttggatttagcgaaaatcggatctgtatttgcattgaacggcagaaatcct
gagactggggagcaggtcatctcaaaagatgtcgcaagaatttgcaaaacatttatggtg
acgtgcggaatgtacaatgcaagcggggaattcgcaattaaggtcggaatccctgcgaaa
agcggcgtatccggcgggattatgggcatttcaccttatgatttcgggatcggtattttc
ggtccggcattggacgaaaaaggcaacagcattgcaggtgtaaagctattggaaatcatg
tctgagatgtacagactgagtattttttaa

DBGET integrated database retrieval system